IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mcgrath-2006-1 A dynamically localized protease complex and a polar specificity factor control a cell cycle master regulator. caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot McGrath PT., Iniesta AA., Ryan KR., Shapiro L., McAdams HH. cell lysates taken from LS4326 (CtrA-M2) or LS4328 (ClpX-M2) strains 7A, 7B shapiro@stanford.edu Cell (0092-8674) 2006 Only protein-protein interactions 4 imex curation q9a3a9_cauvc rcdA CC_3295 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MTEVNAFADTPWRAGVIQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAALGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYRLAEEAPADGPAVEELPFGLMNLLQRSERLYERVRHLDRRMYVESPNEEAPRPVQNQLDRLTAAFGG ctra_cauvc Cell cycle transcriptional regulator CtrA Response regulator SokA ctrA sokA CC_3035 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MRVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVDLGKIYDYDLILLDLNLPDMSGIDVLRTLRVAKINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIHAVVRRSKGHAQSVIKTGDIVVNLDAKTVEVNGNRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLAASAHGKHHIETVWGRGYVLRDPNEQVNAA clpx_cauvc ATP-dependent Clp protease ATP-binding subunit ClpX clpX CC_1961 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MTKAASGDTKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREEHKIAFVKSKDGVPTPREICEVLDDYVIGQGHAKKVLAVAVHNHYKRLNHASKNNDVELAKSNILLVGPTGTGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIVLKLLQAADYNVERAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIISARGAAKSIGFGAKVTDPEERRTGEILRNVEPDDLQRFGLIPEFIGRLPVVATLEDLDEAALVKILTEPKNAFVKQYQRLFEMENIGLTFTEDALHQVAKKAIARKTGARGLRSIMEGILLETMFELPTYEGVEEVVVNAEVVEGRAQPLLIYAEKKGGAASA ctra-rcda RcdA interacts with M2 tagged ctrA 328946 N/A 328947 unspecified role unspecified role prey prey N/A 328948 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false clpx-rcda-1 RcdA interacts with M2 tagged clpX 328946 N/A 328947 unspecified role unspecified role prey prey N/A 328949 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false clpx-ctra CtrA-M2 and ClpX interaction shown by CoIP. 328946 N/A 328949 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 328948 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false clpx-rcda RcdA-M2 and ClpX interaction shown by CoIP. 328946 N/A 328947 unspecified role unspecified role bait bait m2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 328949 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false