UniProt UniProt http://www.uniprot.org schmitz-2005-3 IL-33, an interleukin-1-like cytokine that signals via the IL-1 receptor-related protein ST2 and induces T helper type 2-associated cytokines. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Schmitz J., Owyang A., Oldham E., Song Y., Murphy E., McClanahan TK., Zurawski G., Moshrefi M., Qin J., Li X., Gorman DM., Bazan JF., Kastelein RA. E.coli expressed and purified C9orf26/Il-33 was biotinylated and precipitated via avidinbeads in the presence of recombinant ST2/Il1RL1-Fc fusion protein. jfbazan@gene.com Immunity (1074-7613) 2005 Only protein-protein interactions imex curation schmitz-2005-1 IL-33, an interleukin-1-like cytokine that signals via the IL-1 receptor-related protein ST2 and induces T helper type 2-associated cytokines. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schmitz J., Owyang A., Oldham E., Song Y., Murphy E., McClanahan TK., Zurawski G., Moshrefi M., Qin J., Li X., Gorman DM., Bazan JF., Kastelein RA. E.coli expressed and purified C9orf26/Il-33 was biotinylated and precipitated via avidinbeads in the presence of recombinant ST2/Il1RL1-Fc fusion protein. jfbazan@gene.com Immunity (1074-7613) 2005 Only protein-protein interactions imex curation schmitz-2005-2 IL-33, an interleukin-1-like cytokine that signals via the IL-1 receptor-related protein ST2 and induces T helper type 2-associated cytokines. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schmitz J., Owyang A., Oldham E., Song Y., Murphy E., McClanahan TK., Zurawski G., Moshrefi M., Qin J., Li X., Gorman DM., Bazan JF., Kastelein RA. E.coli expressed and purified C9orf26/Il-33 was biotinylated and precipitated via avidinbeads in the presence of recombinant ST2/Il1RL1-Fc fusion protein. jfbazan@gene.com Immunity (1074-7613) 2005 Only protein-protein interactions imex curation ilrl1_human Interleukin-1 receptor-like 1 Protein ST2 IL1RL1 DER4 ST2 T1 protein protein human Homo sapiens Human MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPLAAQKQ myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV irak4_human Interleukin-1 receptor-associated kinase 4 Renal carcinoma antigen NY-REN-64 IRAK4 protein protein human Homo sapiens Human MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS il33_human Interleukin-33 Interleukin-1 family member 11 Nuclear factor from high endothelial venules IL33 C9orf26 IL1F11 NFHEV protein protein human Homo sapiens Human MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET st2-myd88-1 506354 N/A 506357 unspecified role unspecified role bait bait N/A 506358 unspecified role unspecified role prey prey physical association physical association false false false 3D Interaction has been detected after stimulation with C9orf26/Il-33 interleukin-1-like cytokine. st2-traf6-1 506354 N/A 506357 unspecified role unspecified role bait bait N/A 506359 unspecified role unspecified role prey prey physical association physical association false false false 3D Interaction has been detected after stimulation with C9orf26/Il-33 interleukin-1-like cytokine. st2-irak4-1 506354 N/A 506357 unspecified role unspecified role bait bait N/A 506360 unspecified role unspecified role prey prey physical association physical association false false false 3D Interaction has been detected after stimulation with C9orf26/Il-33 interleukin-1-like cytokine. c9orf26-il1rl1-1 506355 N/A 506357 unspecified role unspecified role prey prey st2-fc ST2/IL1RL1-Fc fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 506361 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3A il1rl1-c9orf26-1 506356 N/A 506357 unspecified role unspecified role bait bait st2-fc ST2/IL1RL1-Fc fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 506361 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3B