IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ etournay-2005-1 PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin JP., Legrain P., Petit C. Mouse inner ear cDNA library created from vestibular sensory epithelia from postnatal day 2 to 6 mice. cpetit@pasteur.fr Mouse inner ear cDNA library. J. Cell. Sci. (0021-9533) 2005 etournay-2005-5 PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin JP., Legrain P., Petit C. Mouse inner ear cDNA library created from vestibular sensory epithelia from postnatal day 2 to 6 mice. cpetit@pasteur.fr Mouse inner ear cDNA library. J. Cell. Sci. (0021-9533) 2005 etournay-2005-2 PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin JP., Legrain P., Petit C. Mouse inner ear cDNA library created from vestibular sensory epithelia from postnatal day 2 to 6 mice. cpetit@pasteur.fr Mouse inner ear cDNA library. J. Cell. Sci. (0021-9533) 2005 etournay-2005-3 PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin JP., Legrain P., Petit C. Mouse inner ear cDNA library created from vestibular sensory epithelia from postnatal day 2 to 6 mice. cpetit@pasteur.fr Mouse inner ear cDNA library. J. Cell. Sci. (0021-9533) 2005 etournay-2005-4 PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin JP., Legrain P., Petit C. Mouse inner ear cDNA library created from vestibular sensory epithelia from postnatal day 2 to 6 mice. cpetit@pasteur.fr Mouse inner ear cDNA library. J. Cell. Sci. (0021-9533) 2005 etournay-2005-6 PHR1, an integral membrane protein of the inner ear sensory cells, directly interacts with myosin 1c and myosin VIIa. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Etournay R., El-Amraoui A., Bahloul A., Blanchard S., Roux I., Pezeron G., Michalski N., Daviet L., Hardelin JP., Legrain P., Petit C. Mouse inner ear cDNA library created from vestibular sensory epithelia from postnatal day 2 to 6 mice. cpetit@pasteur.fr Mouse inner ear cDNA library. J. Cell. Sci. (0021-9533) 2005 q9qye9-2 Pleckstrin homology domain-containing family B member 1 Plekhb1 Evt1 Phr1 Evectin-1 PH domain-containing protein in retina 1 Pleckstrin homology domain retinal protein 1 protein protein mouse Mus musculus Mouse MSPATPVPPDSILESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQECQDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVREDPCYSSGAPLAMGMLAGAATGAALGSLMWSPCWF myo1c_mouse Unconventional myosin-Ic Myosin I beta Myo1c protein protein mouse Mus musculus Mouse MALQVELIPTGEIIRVVHPHRPCKLALGSDGVRVTMESALTARDRVGVQDFVLLENFTSEAAFIENLRRRFRENLIYTYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHLFAVADTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRVVHQNHGERNFHVFYQLLEGGEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDKSDWKVMRKALSVIDFTEDEVEDLLSIVASVLHLGNIHFAADEDSNAQVTTENQLKYLTRLLGVEGTTLREALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVYSRTFTWLVRKINRSLASKDAESPSWRSTTVLGLLDIYGFEVFQHNSFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIAWEPVQYFNNKIICDLVEEKFKGIISILDEECLRPGEATDLTFLEKLEDTVKPHPHFLTHKLADQKTRKSLDRGEFRLLHYAGEVTYSVTGFLDKNNDLLFRNLKETMCSSMNPIMAQCFDKSELSDKKRPETVATQFKMSLLQLVEILRSKEPAYIRCIKPNDAKQPGRFDEVLIRHQVKYLGLMENLRVRRAGFAYRRKYEAFLQRYKSLCPETWPMWAGRPQDGVAVLVRHLGYKPEEYKMGRTKIFIRFPKTLFATEDSLEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHSPRCPENAFFLDHVRASFLLNLRRQLPRNVLDTSWPTPPPALREASELLRELCMKNMVWKYCRSISPEWKQQLQQKAVASEIFKGKKDNYPQSVPRLFISTRLGTEEISPRVLQSLGSEPIQYAVPVVKYDRKGYKPRPRQLLLTPSAVVIVEDAKVKQRIDYANLTGISVSSLSDSLFVLHVQREDNKQKGDVVLQSDHVIETLTKTALSADRVNNININQGSITFAGGPGRDGIIDFTSGSELLITKAKNGHLAVVAPRLNSR myo7a_mouse Unconventional myosin-VIIa Myo7a Myo7 protein protein mouse Mus musculus Mouse MVILQKGDYVWMDLKSGQEFDVPIGAVVKLCDSGQIQVVDDEDNEHWISPQNATHIKPMHPTSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLEGMNEEEKKKLGLGQAADYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHMGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVEKINAAIYKPPPLEVKNSRRSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQEALDMIANRPMNVISLIDEESKFPKGTDATMLHKLNSQHKLNANYVPPKNSHETQFGINHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRHAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLRLKSAATLIQRHWRGHHCRKNYELIRLGFLRLQALHRSRKLHKQYRLARQRIIEFQARCRAYLVRKAFRHRLWAVITVQAYARGMIARRLHRRLRVEYQRRLEAERMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAREDAERELKEKEEARRKKELLEQMEKARHEPINHSDMVDKMFGFLGTSGSLPGQEGQAPSGFEDLERGRREMVEEDVDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQLPEGQKKTSVRHKLVHLTLKKKSKLTEEVTKRLNDGESTVQGNSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTARELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKNLEKWAQLAIAAHKKGIYAQRRTDSQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPPLPKSDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVLLSLGCSDLGCATCQSGRAGLTPAGPCSPCWSCRGTKMMAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTLPPREIVALVTMTPDQRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFVAVLKYMGDYPSKRMRSVNELTDQIFEWALKAEPLKDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIASRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRNSRSGR q9qye9-1 Pleckstrin homology domain-containing family B member 1 Plekhb1 Evt1 Phr1 Evectin-1 PH domain-containing protein in retina 1 Pleckstrin homology domain retinal protein 1 protein protein mouse Mus musculus Mouse MSPATPVPPDSILESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQECQDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPAPAGATVPPRSRRVCPKVRCTTLSWNPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVREDPCYSSGAPLAMGMLAGAATGAALGSLMWSPCWF pkhb1_mouse Pleckstrin homology domain-containing family B member 1 Plekhb1 Phr1 Pleckstrin homology domain retinal protein 1 PH domain-containing protein in retina 1 Evt1 Evectin-1 protein protein mouse Mus musculus Mouse MSPATPVPPDSILESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVVIHFNVRDIKVGQECQDVQPPEGRSRDGLLTVNLREGSRLHLCAETRDDAIAWKTALMEANSTPAPAGATVPPRSRRVCPKVRCTTLSWNPCKVERRIWVRVYSPYQDYYEVVPPNAHEATYVRSYYGPPYAGPGVTHVIVREDPCYSSGAPLAMGMLAGAATGAALGSLMWSPCWF myo1c-plekhb1-1 PHR1, an integral membrane protein, directly interacts with the myosin 1c tail 564109 N/A 564115 unspecified role unspecified role prey prey N/A 564116 unspecified role unspecified role bait bait c-terminal region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 plekbh1-myo7a-1 PHR1 interacts with the myosin VIIa tail 564109 N/A 564117 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 564115 unspecified role unspecified role bait bait physical association physical association false false false myo1c-plekhb1-5 PHR1, an integral membrane protein, directly interacts with the myosin 1c tail. 564110 N/A 564116 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 564118 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2 The presence of 50 micromolar calcium, 100 micromolar EGTA or calmodulin (1.5-15.0 Micromolar concentrations) on did not affect the reaction. plekhb1-myo1c-1 PHR1, an integral membrane protein, directly interacts with the myosin 1c tail. 564110 N/A 564116 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 564118 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2 The presence of 50 micromolar calcium, 100 micromolar EGTA or calmodulin (1.5-15.0 Micromolar concentrations) on did not affect the reaction. myo1c-plekhb1-2 PHR1, an integral membrane protein, directly interacts with the myosin 1c tail 564111 N/A 564118 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 564116 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 1c myo1c-plekhb1-3 PHR1, an integral membrane protein, directly interacts with the myosin 1c tail. 564112 N/A 564115 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 564116 unspecified role unspecified role bait bait c-terminal region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1E myo1c-plekhb1-4 PHR1, an integral membrane protein, directly interacts with the myosin 1c tail. 564113 N/A 564118 unspecified role unspecified role prey prey ph domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 564116 unspecified role unspecified role bait bait c-terminal region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1F The initial GST tag of the PHR1a fragment (Q9QYE9-1) was cleaved off with thrombin. plekhb1-myo7a-2 PHR1 interacts with the myozin VIIa tail 564114 N/A 564117 unspecified role unspecified role prey prey c terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 564119 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B