IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ berthoux-2005-1 Disruption of human TRIM5alpha antiviral activity by nonhuman primate orthologues. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Berthoux L., Sebastian S., Sayah DM., Luban J. The mutants lacking the SPRY domain could not interact with HIV-1 GAG protein. Protein TRIMStop, a truncated version of TRIMCyp lacking the CypA domain was used. 4A JL45@columbia.edu J. Virol. (0022-538X) 2005 berthoux-2005-2 Disruption of human TRIM5alpha antiviral activity by nonhuman primate orthologues. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Berthoux L., Sebastian S., Sayah DM., Luban J. The mutants lacking the SPRY domain could not interact with HIV-1 GAG protein. Protein TRIMStop, a truncated version of TRIMCyp lacking the CypA domain was used. 4A JL45@columbia.edu J. Virol. (0022-538X) 2005 berthoux-2005-3 Disruption of human TRIM5alpha antiviral activity by nonhuman primate orthologues. human-te671 Homo sapiens medulloblastoma te671 Human Caucasian medulloblastoma fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Berthoux L., Sebastian S., Sayah DM., Luban J. The mutants lacking the SPRY domain could not interact with HIV-1 GAG protein. Protein TRIMStop, a truncated version of TRIMCyp lacking the CypA domain was used. 4A JL45@columbia.edu J. Virol. (0022-538X) 2005 q9c035-1 Tripartite motif-containing protein 5 TRIM5 RNF88 RING finger protein 88 RING-type E3 ubiquitin transferase TRIM5 protein protein human Homo sapiens Human MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHTPSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS q2y080_aotaz Peptidyl-prolyl cis-trans isomerase protein protein aotaz Aotus azarai (Southern owl monkey) Aotus azarae MVNPTVFFDIAVDGEPLGRVSFELFADKLPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTPHNGTGGKSIYGVKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNVVEAMERFGCRYGKTSKKITIADCGQL trim5_macmu Tripartite motif-containing protein 5 TRIM5 TRIM5alpha RING-type E3 ubiquitin transferase TRIM5 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWVDVTLAPNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS trim5-trimcyp 363441 N/A 363444 unspecified role unspecified role bait bait N/A 363445 unspecified role unspecified role prey prey physical association physical association false false false The mutants TRIMStop and hu TRIMStop showed interaction.TRIMStop is a truncated version of TRIMCyp lacking the CypA domain. trim5-trimcyp-1 363441 N/A 363445 unspecified role unspecified role prey prey n/a 363446 unspecified role unspecified role bait bait physical association physical association false false false The mutants TRIMStop and hu TRIMStop showed interaction. Interaction was also observed with huTRIMStop. TRIMStop is a truncated version of TRIMCyp lacking the CypA domain. trimcyp-trimcyp 363441 N/A 363445 unspecified role unspecified role bait bait N/A 363445 unspecified role unspecified role prey prey physical association physical association false false false The mutants TRIMStop and TRIMStop showed interaction.TRIMStop is a truncated version of TRIMCyp lacking the CypA domain. trimcyp-trim5 363442 N/A 363445 unspecified role unspecified role prey prey N/A 363444 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Interaction was also observed with the SPRY deficiient TRIMStop form of TRIMCyp. trimcyp-trim5-1 363443 N/A 363445 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 363444 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Interaction was also observed with the SPRY deficiient TRIMStop form of TRIMCyp.