IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ teige-2004-1 The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Teige M., Scheikl E., Eulgem T., Doczi R., Ichimura K., Shinozaki K., Dangl JL., Hirt H. markus.teige@univie.ac.at Mol. Cell (1097-2765) 2004 Only protein-protein interactions imex curation teige-2004-2 The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay predetermined predetermined participant predetermined Teige M., Scheikl E., Eulgem T., Doczi R., Ichimura K., Shinozaki K., Dangl JL., Hirt H. markus.teige@univie.ac.at Mol. Cell (1097-2765) 2004 Only protein-protein interactions imex curation m2k2_arath Mitogen-activated protein kinase kinase 2 MKK2 MAP2K MK1 At4g29810 F27B13.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKKGGFSNNLKLAIPVAGEQSITKFLTQSGTFKDGDLRVNKDGVRIISQLEPEVLSPIKPADDQLSLSDLDMVKVIGKGSSGVVQLVQHKWTGQFFALKVIQLNIDEAIRKAIAQELKINQSSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKAIPDSYLSAIFRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMTNTAGLANTFVGTYNYMSPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPALPSGNFSPELSSFISTCLQKDPNSRSSAKELMEHPFLNKYDYSGINLASYFTDAGSPLATLGNLSGTFSV mpk4_arath Mitogen-activated protein kinase 4 MPK4 At4g01370 F2N1.1 F2N1_2-t protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAESCFGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKFNPQDSV mpk6_arath Mitogen-activated protein kinase 6 MPK6 At2g43790 F18O19.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ mpk5_arath Mitogen-activated protein kinase 5 MPK5 At4g11330 F8L21.120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKEIESATDLGDTNIKGVLVHGGRYFQYNVYGNLFEVSNKYVPPIRPIGRGAYGFVCAAVDSETHEEIAIKKIGKAFDNKVDAKRTLREIKLLRHLEHENVVVIKDIIRPPKKEDFVDVYIVFELMDTDLHQIIRSNQSLNDDHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNSNCDLKITDFGLARTTSETEYMTEYVVTRWYRAPELLLNSSEYTSAIDVWSVGCIFAEIMTREPLFPGKDYVHQLKLITELIGSPDGASLEFLRSANARKYVKELPKFPRQNFSARFPSMNSTAIDLLEKMLVFDPVKRITVEEALCYPYLSALHDLNDEPVCSNHFSFHFEDPSSTEEEIKELVWLESVKFNPLPSI m2k1_arath Mitogen-activated protein kinase kinase 1 NMAPKK AtMEK1 MKK1 MEK1 At4g26070 F20B18.180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNRGSLCPNPICLPPLEQSISKFLTQSGTFKDGDLRVNKDGIQTVSLSEPGAPPPIEPLDNQLSLADLEVIKVIGKGSSGNVQLVKHKLTQQFFALKVIQLNTEESTCRAISQELRINLSSQCPYLVSCYQSFYHNGLVSIILEFMDGGSLADLLKKVGKVPENMLSAICKRVLRGLCYIHHERRIIHRDLKPSNLLINHRGEVKITDFGVSKILTSTSSLANSFVGTYPYMSPERISGSLYSNKSDIWSLGLVLLECATGKFPYTPPEHKKGWSSVYELVDAIVENPPPCAPSNLFSPEFCSFISQCVQKDPRDRKSAKELLEHKFVKMFEDSDTNLSAYFTDAGSLIPPLAN mkk2-mpk4 Directed yeast two hybrid assay reveals interaction between MKK2 protein and MPK4 protein 506457 N/A 506459 unspecified role unspecified role bait bait N/A 506460 unspecified role unspecified role prey prey physical association physical association false false false Figure 1A and 1B mkk2-mpk6 Directed yeast two hybrid assay reveals interaction between MKK2 protein and MPK6 protein 506457 N/A 506459 unspecified role unspecified role bait bait N/A 506461 unspecified role unspecified role prey prey physical association physical association false false false Figure 1A and 1B mkk2-mpk5 Directed yeast two hybrid assay reveals interaction between MKK2 protein and MPK5 protein 506457 N/A 506462 unspecified role unspecified role prey prey N/A 506459 unspecified role unspecified role bait bait physical association physical association false false false Figure 1A and 1B Interaction of MKK2 and MPK5 was judged to be 'weak' from results of beta-galastosidase assay (Figure 1B). mkk1-mpk4 Direced yeast two hybrid assay reveals interaction between MKK1 protein and MPK4 protein 506457 N/A 506463 unspecified role unspecified role bait bait N/A 506460 unspecified role unspecified role prey prey physical association physical association false false false Figure 1A and 1B mkk2-mpk6-1 Phosphorylation assay reveals interaction between MKK2 protein and MPK6 protein 506458 N/A 506459 enzyme enzyme unspecified role unspecified role N/A 506461 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false Figure 1C mkk2-mpk4-1 Phosphorylation assay reveals interaction between MKK2 protein and MPK4 protein 506458 N/A 506460 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 506459 enzyme enzyme unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation false false false Figure 1C mkk1-mpk4-1 Phosphorylation assay reveals interaction between MKK1 protein and MPK4 protein 506458 N/A 506463 enzyme enzyme unspecified role unspecified role N/A 506460 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false Figure 1C