UniProt UniProt http://www.uniprot.org chattopadhy-2002-1 Interaction with Btn2p is required for localization of Rsglp: Btn2p-mediated changes in arginine uptake in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid partial dna sequence hybrid partial dna sequence identification by hybridization partial dna sequence hybrid Chattopadhyay S., Pearce DA. The experiment used the Cytotrap (stratagene) two-hybrid system based on human SOS-fusion for the bait and a cDNA library fused to a myristoylation signal to identify the preys. david_pearce@urmc.rochester.edu Eukaryotic Cell (1535-9778) 2002 Only protein-protein interactions imex curation chattopadhy-2002-2 Interaction with Btn2p is required for localization of Rsglp: Btn2p-mediated changes in arginine uptake in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chattopadhyay S., Pearce DA. The experiment used the Cytotrap (stratagene) two-hybrid system based on human SOS-fusion for the bait and a cDNA library fused to a myristoylation signal to identify the preys. david_pearce@urmc.rochester.edu Eukaryotic Cell (1535-9778) 2002 Only protein-protein interactions imex curation btn2_yeast Protein BTN2 YGR142W BTN2 Batten disease protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSIFNSPCVFEQLPSFSQPLHSRYFDCSSPVSYYPECKRRKAIKANLRAPKKSDANCSEPLRYALAETPNGYTLSLSKRIPYELFSKYVNEKLGELKENHYRPTYHVVQDFFGNQYYVEDEADEDALLRSALKDLDFRAIGKKIAKDLFQDYEIELNHRGDELSILSKKDKIFKEFSLDQVFEDVFVIGCGVENIDDGSREKYALLKIGLVKHEEEISEGGINEPKMPIIESKIDESHDDVNMSESLKEEEAEKAKEPLTKEDQIKKWIEEERLMQEESRKSEQEKAAKEDEERQKKEKEARLKARKESLINKQKTKRSQQKKLQNSKSLPISEIEASNKNNNSNSGSAESDNESINSDSDTTLDFSVSGNTLKKHASPLLEDVEDEEVDRYNESLSRSPKGNSIIEEI E7AE1EB1E3612F3E rheb_yeast Rheb-like protein RHB1 RHB1 RSG1 YCR027C YCR27C GTP-binding protein RSG1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEYATMSSSNSTHNFQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGTKADLGRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFMLLLKQMERVEGTLGLDAENNNKCSIM 39F40E70342D7AD5 btn2-rsg1 Interaction detected by Y2H 499501 N/A 499503 unspecified role unspecified role bait bait N/A 499504 unspecified role unspecified role prey prey physical association physical association false false false 1A btn2-rsg1-1 Interaction detected by CoIP 499502 N/A 499504 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 499503 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1B