IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xie-2002-1 Reconstitution and characterization of the human DNA polymerase delta four-subunit holoenzyme. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom western blot western blot Immuno blot Immuno blot Xie B., Mazloum N., Liu L., Rahmeh A., Li H., Lee MY. Lysates of Sf9 cells for all four subunits, co-infected with FPLC chromatography on Source15Q, MonoQ, and Superose 6 or Superdex 200 gel filtration columns. Fig. 1 and 10 Marietta_Lee@NYMC.edu Biochemistry (0006-2960) 2002 xie-2002-2 Reconstitution and characterization of the human DNA polymerase delta four-subunit holoenzyme. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xie B., Mazloum N., Liu L., Rahmeh A., Li H., Lee MY. Lysates of Sf9 cells for all four subunits, co-infected with FPLC chromatography on Source15Q, MonoQ, and Superose 6 or Superdex 200 gel filtration columns. Fig. 1 and 10 Marietta_Lee@NYMC.edu Biochemistry (0006-2960) 2002 xie-2002-3 Reconstitution and characterization of the human DNA polymerase delta four-subunit holoenzyme. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Xie B., Mazloum N., Liu L., Rahmeh A., Li H., Lee MY. Lysates of Sf9 cells for all four subunits, co-infected with FPLC chromatography on Source15Q, MonoQ, and Superose 6 or Superdex 200 gel filtration columns. Fig. 1 and 10 Marietta_Lee@NYMC.edu Biochemistry (0006-2960) 2002 xie-2002-4 Reconstitution and characterization of the human DNA polymerase delta four-subunit holoenzyme. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Xie B., Mazloum N., Liu L., Rahmeh A., Li H., Lee MY. Lysates of Sf9 cells for all four subunits, co-infected with FPLC chromatography on Source15Q, MonoQ, and Superose 6 or Superdex 200 gel filtration columns. Fig. 1 and 10 Marietta_Lee@NYMC.edu Biochemistry (0006-2960) 2002 xie-2002-5 Reconstitution and characterization of the human DNA polymerase delta four-subunit holoenzyme. in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Xie B., Mazloum N., Liu L., Rahmeh A., Li H., Lee MY. Lysates of Sf9 cells for all four subunits, co-infected with FPLC chromatography on Source15Q, MonoQ, and Superose 6 or Superdex 200 gel filtration columns. Fig. 1 and 10 Marietta_Lee@NYMC.edu Biochemistry (0006-2960) 2002 dpod3_human DNA polymerase delta subunit 3 DNA polymerase delta subunit p66 POLD3 KIAA0039 DNA polymerase delta subunit C DNA polymerase delta subunit p68 protein protein human Homo sapiens Human MADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSSKKFEQSHLHMSSETQANNELTTNGHGPPASKQVSQQPKGIMGMFASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKGNMMSNFFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK dpod1_human DNA polymerase delta catalytic subunit 3'-5' exodeoxyribonuclease DNA polymerase subunit delta p125 POLD1 POLD protein protein human Homo sapiens Human MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQSVLEGVADGQVPPSAIDPRWLRPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSRGSVPVLRAFGVTDEGFSVCCHIHGFAPYFYTPAPPGFGPEHMGDLQRELNLAISRDSRGGRELTGPAVLAVELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPSFAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPFLGRVAGLCSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRGQQVKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRTPTGDEFVKTSVRKGLLPQILENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAADWVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLVANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQLVITKELTRAASDYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQEQLLRRFGPPGPEAW dpod2_human DNA polymerase delta subunit 2 POLD2 DNA polymerase delta subunit p50 protein protein human Homo sapiens Human MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP dpod4_human DNA polymerase delta subunit 4 DNA polymerase delta subunit p12 POLD4 POLDS protein protein human Homo sapiens Human MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL dpod1_bovin DNA polymerase delta catalytic subunit 3'-5' exodeoxyribonuclease POLD1 protein protein bovin Bos taurus (Bovine) Bovine MDGKRRPGPGPGVPPKRARGGLWDEDEAYRPSQFEEELALMEEMEAERRLQEQEEEELQSALEAADGQFSPTAIDARWLRPAPPALDPQMEPLIFQQLEIDHYVAPARPLPGAPPPSQDSVPILRAFGVTNEGVSVCCHIHGFAPYFYTPAPPGFGPEHLSELQRELSAAISRDQRGGKELTGPAVLAVELCSRESMFGYHGHGPSPFLRITLALPRLMAPARRLLEQGIRLAGLGTPSFAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYILRPEGKATLCQLEADVLWSDVISHPPEGEWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEREEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVPGFPLLGRVIGLRSNIRESSFQSRQTGRRDSKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAFLPLRLLERLMVLVNAMEMARVTGVPLGYLLSRGQQVKVVSQLLRQAMRQGLLMPVVKTEGGEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLTEDQFIKTPTGDEFVKASVRKGLLPQILENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGRLPCLEISQSVTGFGRQMIEKTKQLVETKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAADWVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLVANLVTASLRRLLIDRDPSGAVAHAQDVISDLLCNRIDISQLVITKELTRAAADYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLSHQGAVCKFCQPRESELYQKEVSHLSALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQERLLRRFGPPGPEAW pold1-pold2-1 Assembly of DNA polymerase delta identifed by column chromotography 332300 N/A 332305 unspecified role unspecified role neutral component neutral component N/A 332306 unspecified role unspecified role neutral component neutral component N/A 332307 unspecified role unspecified role neutral component neutral component N/A 332308 unspecified role unspecified role neutral component neutral component physical association physical association false false false P28340; P49005; Q15054; Q9HCU8; infection pold1-pold2-3 Assembly of DNA polymerase delta subunits 1 and 2 identifed by column chromotography 332300 N/A 332306 unspecified role unspecified role neutral component neutral component N/A 332307 unspecified role unspecified role neutral component neutral component physical association physical association false false false P28340; P49005; infection pold1-pold4-1 Assembly of DNA polymerase delta subunits 1 and 4 identifed by column chromotography 332300 N/A 332308 unspecified role unspecified role neutral component neutral component N/A 332306 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false P28340; Q9HCU8; infection pold1-pold2-4 Assembly of DNA polymerase delta identifed by column chromotography 332301 N/A 332306 unspecified role unspecified role neutral component neutral component N/A 332305 unspecified role unspecified role neutral component neutral component N/A 332307 unspecified role unspecified role neutral component neutral component N/A 332308 unspecified role unspecified role neutral component neutral component physical association physical association false false false P28340; P49005; Q15054; Q9HCU8; infection Stokes radius = 61 � on Superose 6 and 57 � on Superdex 200 pold1-pold2-5 Assembly of DNA polymerase delta subunits 1 and 2 identifed by column chromotography 332301 N/A 332307 unspecified role unspecified role neutral component neutral component N/A 332306 unspecified role unspecified role neutral component neutral component physical association physical association false false false P28340; P49005; infection Stokes radii = 48 � on Superose 6 and 47 � on Superdex 200. pold1-pold2-6 Assembly of DNA polymerase delta identifed by glycerol gradient centrifugation 332302 N/A 332305 unspecified role unspecified role neutral component neutral component N/A 332306 unspecified role unspecified role neutral component neutral component N/A 332307 unspecified role unspecified role neutral component neutral component N/A 332308 unspecified role unspecified role neutral component neutral component physical association physical association false false false P28340; P49005; Q15054; Q9HCU8; infection Sedimentation coefficient = 9.2 S. The molecular weight calculated from the Stokes radii and the sedimentation coefficients was 230kDa, calculated mw was 239kDa. pold1-pold2-7 Assembly of DNA polymerase delta identifed by glycerol gradient centrifugation 332302 N/A 332307 unspecified role unspecified role neutral component neutral component N/A 332306 unspecified role unspecified role neutral component neutral component N/A 332305 unspecified role unspecified role neutral component neutral component N/A 332308 unspecified role unspecified role neutral component neutral component physical association physical association false false false P28340; P49005; Q15054; Q9HCU8; infection Sedimentation coefficient = 7.8S. The molecular weight calculated from the Stokes radii and the sedimentation coefficients was 155kDa, the calculated mw was 175kDa pold1pold2-8 Interaction of POLD4 with POLD1 identified by coimmunoprecipitation 332303 N/A 332308 unspecified role unspecified role bait bait N/A 332306 unspecified role unspecified role prey prey physical association physical association false false false P28340; Q9HCU8; endogenous pold1-pold2-9 Interaction of POLD4 with POLD1 identified by GST-pulldown 332304 N/A 332309 unspecified role unspecified role prey prey N/A 332308 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) physical association physical association false false false