UniProt UniProt http://www.uniprot.org kitagawa-2000-1 Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp rat liver cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation kitagawa-2000-2 Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp rat liver cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation kitagawa-2000-3 Direct association of LIS1, the lissencephaly gene product, with a mammalian homologue of a fungal nuclear distribution protein, rNUDE. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kitagawa M., Umezu M., Aoki J., Koizumi H., Arai H., Inoue K. harai@mol.f.u-tokyo.ac.jp rat liver cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation nde1_rat Nuclear distribution protein nudE homolog 1 Nde1 Nude Nude1 protein protein rat Rattus norvegicus (Rat) Rat MEDSGKTFGSEEEETNYWRDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQAETRNRDLLSENNRLRMELESVKEKFEMQHSEGYRQISALEDDLAHTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQDKPRTPMPSSGETKRTDMAVQATGSAPSTPITHQGSSSGLNTPETFRCGLGSPSSGTPLTPAARISALNIVGDLLRKVGALESKLASCKNFMYDQSPSRKSGPALGRGTKNRDGIDRRPGSTAVGDKGSGKRLEFAKPSSQLSSPALPSTQGVVKLLL lis1_bovin Platelet-activating factor acetylhydrolase IB subunit beta PAF-AH alpha Lissencephaly-1 protein PAF acetylhydrolase 45 kDa subunit PAFAH1B1 LIS1 PAFAHA protein protein bovin Bos taurus (Bovine) Bovine MVLSQRQRDELNRAIADYLRSNGYEAAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVEDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR pa1b2_rat Platelet-activating factor acetylhydrolase IB subunit alpha2 PAF acetylhydrolase 30 kDa subunit PAF-AH subunit beta Platelet-activating factor acetylhydrolase alpha 2 subunit Pafah1b2 Pafahb protein protein rat Rattus norvegicus (Rat) Rat MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA g3hvb8_crigr Platelet-activating factor acetylhydrolase IB subunit alpha PAFAH1B1 LIS1 Lissencephaly-1 protein PAF acetylhydrolase 45 kDa subunit PAF-AH alpha I79_014899 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR pa1b3_rat Platelet-activating factor acetylhydrolase IB subunit alpha1 PAF acetylhydrolase 29 kDa subunit PAF-AH subunit gamma Platelet-activating factor acetylhydrolase alpha 1 subunit Pafah1b3 Pafahg protein protein rat Rattus norvegicus (Rat) Rat MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAP lis1_nde1_1 509815 N/A 509818 unspecified role unspecified role prey prey N/A 509819 unspecified role unspecified role bait bait physical association physical association false false false None. lis1_pafah1b2 _1 509815 N/A 509819 unspecified role unspecified role bait bait N/A 509820 unspecified role unspecified role prey prey physical association physical association false false false None. nde1_lis1_1 509816 N/A 509818 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 509819 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2, 3A Transfection with Optimem. nde1_lis1_2 509816 N/A 509821 unspecified role unspecified role prey prey N/A 509818 unspecified role unspecified role bait bait n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2, 4A This interaction is inhibited in the presence of Pafah1b2 and Pafah1b3. Transfection with Optimem. pafah1b3_lis1_2 509817 N/A 509819 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 509822 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3B pafah1b2_lis1_1 509817 N/A 509819 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 509820 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3B