IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ richardson-2000-1 Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. mouse-myeloma_66_2 Mus musculus myeloma cell line myeloma_66_2 mouse myeloma 66-2 cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation richardson-2000-2 Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation richardson-2000-3 Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Richardson RT., Batova IN., Widgren EE., Zheng LX., Whitfield M., Marzluff WF., O'Rand MG. Chromatin - Epigenetic interactions resulting in chromatin modulation Reverse-phase HPLC separation and identification of mouse histones bound to affinity-purified native NASP was carried out. 11A morand@unc.edu Precipitation was carried out with affinity purified anti-rNASP antibodies. J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation h12_mouse Histone H1.2 H1-2 H1 VAR.1 H1c H1f2 Hist1h1c protein protein mouse Mus musculus Mouse MSEAAPAAPAAAPPAEKAPAKKKAAKKPAGVRRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGILVQTKGTGASGSFKLNKKAASGEAKPQAKKAGAAKAKKPAGAAKKPKKATGAATPKKAAKKTPKKAKKPAAAAVTKKVAKSPKKAKVTKPKKVKSASKAVKPKAAKPKVAKAKKVAAKKK h14_mouse Histone H1.4 H1-4 H1 VAR.2 H1e H1f4 Hist1h1e protein protein mouse Mus musculus Mouse MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKRAGAAKAKKPAGAAKKPKKAAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAKPKKTAAKKK h13_mouse Histone H1.3 H1-3 H1 VAR.4 H1d H1f3 Hist1h1d protein protein mouse Mus musculus Mouse MSETAPAAPAAPAPVEKTPVKKKAKKTGAAAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKKATGAATPKKTAKKTPKKAKKPAAAAGAKKVSKSPKKVKAAKPKKAAKSPAKAKAPKAKASKPKASKPKATKAKKAAPRKK h15_mouse Histone H1.5 H1-5 H1 VAR.5 H1b H1f5 Hist1h1b protein protein mouse Mus musculus Mouse MSETAPAETAAPAPVEKSPAKKKTTKKAGAAKRKATGPPVSELITKAVSASKERGGVSLPALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKTGAAKAKKPAGATPKKPKKTAGAKKTVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKAAKSPAKPKAVKSKASKPKVTKPKTAKPKAAKAKKAVSKKK nasp_mouse Nuclear autoantigenic sperm protein Nasp protein protein mouse Mus musculus Mouse MATESTAAAAIAAELVSADKIEDAPAPSTSADKMESLDVDSEAKKLLGLGQKHLVMGDIPAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEEGEKTEDESLVENNDNVDEEAREELREQVYDAMGEKEAKKAEGKSLTKPETDKEQESEVEKGGREDMDISEPEEKLQETVEPTSKQLTESSEEAKEAAIPGLNEDEVASGKTEQESLCTEKGKSISGAYVQNKEFRETVEEGEEIISLEKKPKETSEDQPIRAAEKQGTLMKVVEIEAEIDPQVKSADVGGEEPKDQVATSESELGKAVLMELSGQDVEASPVVAAEAGAEVSEKPGQEITVIPNNGPVVGQSTVGDQTPSEPQTSAERLTETKDGSSVEEVKAELVPEQEEAMLPVEESEAAGDGVETKVAQKATEKAPEDKFKIAANEETPERDEQMKEGEETEGSEEEDRENDKAEETPNESVLEKKSLQENEEEEIGNLELAWDMLDLAKIIFKRQETKEAQLYAAQAHLKLGEVSVESENYIQAVEEFQACLSLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFGKSIDVIEKRMAVLHEQMKEAEGSFTEYEKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLVESSTSGFTPSGAGASVSMIASRKPTDGASSSNCVTDISHLVRKKRKPEEESPRKDDAKKAKQEPEVNGGSGDAVSSGKEVSENMEAEAENQAESQTAEGTVESAATIKSTAC nasp-hist1h1b nasp histone interactions determined by HPLC. 361934 N/A 361937 unspecified role unspecified role prey prey N/A 361938 unspecified role unspecified role prey prey N/A 361939 unspecified role unspecified role prey prey N/A 361940 unspecified role unspecified role prey prey N/A 361941 unspecified role unspecified role bait bait association association false false false nasp-hist1h1c-1 nasp histone interactions determined by pull down. 361935 N/A 361941 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 361937 unspecified role unspecified role bait bait biotin fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false nasp-hist1h1c-2 nasp histone interactions determined by CoIP. 361936 N/A 361941 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 361937 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false