IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mizuno-1999-1 Molecular architecture of the mouse DNA polymerase alpha-primase complex. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation mizuno-1999-2 Molecular architecture of the mouse DNA polymerase alpha-primase complex. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation mizuno-1999-3 Molecular architecture of the mouse DNA polymerase alpha-primase complex. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down western blot western blot Immuno blot Immuno blot Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation mizuno-1999-4 Molecular architecture of the mouse DNA polymerase alpha-primase complex. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Mizuno T., Yamagishi K., Miyazawa H., Hanaoka F. Using an IRES derived from poliovirus, plasmids were designed to coexpress p180 and p68 and also p54 and p46. These are then suitable for the transfection of three or four subunits simultaneously because all of the cells expressing p180 will contain p68 and all of the cells expressing p54 will contain p46 at constant ratios. 1C, 2B, 2C, 3B fhanaoka@imcb.osaka-u.ac.jp Mol. Cell. Biol. (0270-7306) 1999 Only protein-protein interactions imex curation pri1_mouse DNA primase small subunit DNA primase 49 kDa subunit Prim1 protein protein mouse Mus musculus Mouse MEPFDPAELPELLKLYYRRLFPYAQYYRWLNYGGVTKNYFQHREFSFTLKDDIYIRYQSFNNQSELEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKYFEEYALVGQDILENKENWDKILALVPETIHDELQRGFQKFHSSPQRWEHLRKVANSSQNMKNDKCGPWLEWEVMLQYCFPRLDVNVSKGVNHLLKSPFSVHPKTGRISVPIDFHKVDQFDPFTVPTISAICRELDMVSTHEKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSDLQKDF pri2_mouse DNA primase large subunit DNA primase 58 kDa subunit Prim2 protein protein mouse Mus musculus Mouse MQFSGRIRKKLRLAGDQRNASYPHSLQFYLQPPTENISLTEFENLAFDRVKLLKAIENLGVSYVKGTEQYQSKLEAEIRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEDLRRWFIQQEMDLLRFRFSILPKDKVQSFLKDSHLHFEAISDEEKTLREQDIMASSPSLSGIKLESESVYKVPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRATLSKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQKNTGKISLDQIDSLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIRGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCMKIILTNPPGQGDYHGCPFRHSDAELLKQKMQSYKIPASGISQILDLVKGNHYQVACQKYFEMTHNVDDCGFSLNHPNQFFFESQRILTGGKDIKKEISQPETPQHKPSTQKTRDAASALASLDSSLEMDLEGLEEYF dpoa2_mouse DNA polymerase alpha subunit B DNA polymerase alpha 70 kDa subunit Pola2 protein protein mouse Mus musculus Mouse MAVSTQQLAEELQIFGLDYEDSLLEKLAELCVLYRQTEDGMVSELIAFCTSAGKTCLTVDILNSFEYEVLNKKLSKAWHSASKDSGHAGTRDIVSIQELIEAEEEEETLLSSYTTPSKGPLKRVSSTPETPLTKRSVAARSPRQLLSPSSFSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPEPLTGSYKAMFQQLMGVREVLTSKIEELGSELKEHHKIEAFTPLLVPAQEPVILLGQIGCDSNGKLNSKSVILEGDQEHSYGAQIPVDLSELKEYSLFPGQVVIMEGFNTTGRRLTATKLYEGVPLPFYQPTEEEGASEQTMVVVACGPYTTSDSITYDPLLDLIAIINRDQPDVCILFGPFLDAKHEQVENCKLTSPFEDVFKQCLRTVIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFTFSELSREDKKRVQFVSEPCSLSINGVMFGLTSTDLLFHIGAEEIFSSSGTSDRFSRVLKHILTQRSYYPLYPPHEDMAIDYENFYTYAQLPVTPDVFIVPSELRYFVKDIFGCVCVNPGRLTKGQVGGTFGRLYLRRQPKAMDGGGRQGLSVAAQVVRI dpola_mouse DNA polymerase alpha catalytic subunit Pola1 Pola DNA polymerase alpha catalytic subunit p180 protein protein mouse Mus musculus Mouse MAPMHEEDCKLEASAVSDSGSFAASRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDLTSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGKAHRKDRKDVKKPSVTKPNNIKAMFIASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQITPPPVLIPKKKRSTGALLNPFSVHTPKAIPSGKPASPVLRNEPLLTPIPLKRAELAGELAQPECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEHEADPERGTTSYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVKGADDEQVFQFYWLDAYEDPYNQPGVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETAIPVTMKDVYEEFDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPPLVVMSFSMKTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPCDFKEVISKKNMKVEIAATERTLIGFFLAKVHKIDPDILVGHNICSFELEVLLQRINECKVPYWSKIGRLRRSNMPKLGSRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQILKTERIVIPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKATYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVTSEVQKATEDEEQEQIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKDMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDAVFKSLLLLKKKKYAALVVEPTSDGNYITKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDRKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTATQRAYAPEQLQKLDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEENDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEPSLYRCSNVDCKVSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRLPLHFSRNGPLCPVCMKAVLRPEYSDKSLYTQLCFYRYIFDADCALEKLTEHEKDKLKKQFFPLRVLQDYRKVKNIAEQFLSWSGYSEVNLSKLFANYAGKS prim2-prim1-1 Interaction between murine Prim1 and Prim2 detected by colocalisation 328396 N/A 328400 unspecified role unspecified role neutral component neutral component n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 328401 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false pola-pola2-1 Interaction between murine Pola and Pola1 detected by colocalisation 328396 N/A 328402 unspecified role unspecified role neutral component neutral component N/A 328403 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false pola-pola2-2 Interaction between murine Prim2, Pola and Pola1 detected by colocalisation 328396 N/A 328401 unspecified role unspecified role neutral component neutral component N/A 328402 unspecified role unspecified role neutral component neutral component N/A 328403 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false pola-pola2-3 Interaction between murine Prim1, Prim2, Pola and Pola2 detected by colocalisation 328396 N/A 328401 unspecified role unspecified role neutral component neutral component N/A 328400 unspecified role unspecified role neutral component neutral component N/A 328402 unspecified role unspecified role neutral component neutral component N/A 328403 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false pola-prim1-4 Interaction between murine Prim1, Prim2, and Pola detected by colocalisation 328396 N/A 328401 unspecified role unspecified role neutral component neutral component N/A 328400 unspecified role unspecified role neutral component neutral component N/A 328403 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false pola-prim1-5 Interaction between murine Prim1, Prim2, and Pola detected by colocalisation 328396 N/A 328400 unspecified role unspecified role neutral component neutral component N/A 328401 unspecified role unspecified role neutral component neutral component N/A 328403 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false pola-prim1-6 Interaction between murine Prim1 and Pola detected by coimmunoprecipitation 328397 N/A 328400 unspecified role unspecified role bait bait N/A 328403 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false prim1-pola2-1 Interaction between murine Prim1 and Pola2 detected by coimmunoprecipitation 328397 N/A 328402 unspecified role unspecified role prey prey N/A 328403 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 328400 unspecified role unspecified role bait bait association association false false false P33610 co-expressed in this experiment pola-pola2-4 Interaction between murine Pola and Pola2 detected by pulldown 328398 N/A 328403 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P33609:p.[Cys1287Ala;Cys1290Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P33609:p.[Cys1375Ala;Cys1378Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 328402 unspecified role unspecified role prey prey physical association physical association false false false pola-pola2-5 Interaction between murine Prim1, Prim2, Pola and Pola2 detected by colocalisation 328399 N/A 328402 unspecified role unspecified role neutral component neutral component N/A 328401 unspecified role unspecified role neutral component neutral component N/A 328400 unspecified role unspecified role neutral component neutral component N/A 328403 unspecified role unspecified role neutral component neutral component physical association physical association false false false