MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nemoto-1999-2 Recruitment of an alternatively spliced form of synaptojanin 2 to mitochondria by the interaction with the PDZ domain of a mitochondrial outer membrane protein. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Nemoto Y., De Camilli P. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation nemoto-1999-1 Recruitment of an alternatively spliced form of synaptojanin 2 to mitochondria by the interaction with the PDZ domain of a mitochondrial outer membrane protein. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nemoto Y., De Camilli P. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation nemoto-1999-3 Recruitment of an alternatively spliced form of synaptojanin 2 to mitochondria by the interaction with the PDZ domain of a mitochondrial outer membrane protein. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nemoto Y., De Camilli P. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation nemoto-1999-4 Recruitment of an alternatively spliced form of synaptojanin 2 to mitochondria by the interaction with the PDZ domain of a mitochondrial outer membrane protein. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Nemoto Y., De Camilli P. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation nemoto-1999-5 Recruitment of an alternatively spliced form of synaptojanin 2 to mitochondria by the interaction with the PDZ domain of a mitochondrial outer membrane protein. crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Nemoto Y., De Camilli P. EMBO J. (0261-4189) 1999 Only protein-protein interactions imex curation o55207-3 Synaptojanin-2 Synj2 Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 2 7.5kb protein protein rat Rattus norvegicus (Rat) Rat MALSKGLRLLARLDPTGPSSVLLEARGRGDCLLFEAGAVATLAPEEKEVIKGLYGKPTDAYGCLGELSLKSGGVPLSFLVLVTGCTSVGRIPDAEIYKITGTEFYPLQEEAKEEDRLPALKKILSSGVFYFAWPNDGACFDLTIRAQKQGDDCSEWGTSFFWNQLLHVPLRQHQVNCHDWLLKVICGVVTIRTVYASHKQAKACLISRISCERAGARFLTRGVNDDGHVSNFVETEQAIYMDDGVSSFVQIRGSVPLFWEQPGLQVGSHHLRLHRGLEANAPAFERHMVLLKEQYGQQVVVNLLGSRGGEEVLNRAFKKLLWASCHAGDTPMINFDFHQFAKGRKLEKLENLLRPQLKLHWDDFGVFAKGENVSPRFQKGTLRMNCLDCLDRTNTVQCFIALEVLHLQLESLGLNSKPITDRFVESFKAMWSLNGHGLSKVFTGSRALEGKAKVGKLKDGARSMSRTIQSNFFDGVKQEAIKLLLVGDVYNEESTDKGRMLLDNTALLGLGSNKQNSLSGMLDGKATPRILKAMTERQSEFTNFKRIQIAMGTWNVNGGKQFRSNLLGTTELTDWLLDAPQLSGAVDSQDDGGPADIFAVGFEEMVELSAGNIVNASTTNRKMWGEQLQKAISRSHRYILLTSAQLVGVCLYIFVRPYHVPFIRDVAIDTVKTGMGGKAGNKGAVGIRFQFHSTSFCFICSHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEVFYFVKRQDWKKLMEFDQLQLQKSSGKIFKDFHEGTINFGPTYKYDVGSAAYDTSDKCRTPAWTDRVLWWRKKHPYDKTAGELNLLDSDLDGDANIRHTWSPGTLKYYGRAELQASDHRPVLAIVEVEVQEVDVGARERVFQEVSSVQGPLDATVIVNLQSPTLEERNEFPEDLRTELMQTLGNYGTIILVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKIRPKTKDWLEGLREELIRKRDSMAPVSPTANSCLLEENFDFTSLDYESEGDVLEDDEDYLADEFGQPVVSDSELGGDDSSDTMSASTPASKSPALAKKKQHPTYKDDADLMTLKLELEVAGNFRHRSPSRSLSVPNRPRPPHPPQRPPPPTGLMVKKSASDASISSGTHGQYSILQTAKLLPGAPQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEAGGGVPESAPGATPLRNQGSSKPEASLGPPVLPRRPVPRVPTMKKPTLRRTGKIVFCSSSQASQPCSLLQRHEFVRTVAAQRLTPVDASGSSV The PDZ domain of isoform 2A binds SYNJ2BP/OMP25. Mutagenesis of Ser-1246 or Val-1248 to Ala abolishes SYNJ2BP/OMP25 binding. mint syj2b_rat Synaptojanin-2-binding protein Synj2bp Omp25 Mitochondrial outer membrane protein 25 NPW16 protein protein rat Rattus norvegicus (Rat) Rat MNGRVDYLVSEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAARDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLPVQNGPIVHRGDGEPSGVPVAVVLLPVFALTLVAVWAFVRYRKQL mint synj2bp-synj2 361957 o55207-3 361962 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F2A mint synj2bp-synj2-1 361957 o55207-3 361962 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified mbp tagged maltose binding protein tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false F2C mint synj2bp-synj2-2 361957 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 o55207-3 361962 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey cell lysate cell lysate mbp tagged maltose binding protein tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O55207-3:p.Ser1291Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O55207-3:p.Val1293Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O55207-3:p.Gly1290Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3A mint synj2-synj2bp 361958 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 o55207-3 361962 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false NFA mint synj2-synj2bp-1 361958 o55207-3 361962 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O55207-3:p.Val1293Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O55207-3:p.Ser1291Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O55207-3:p.Gly1290Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3B mint synj2bp-synj2-3 361959 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 o55207-3 361962 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false F2B mint synj2bp-synj2-4 361959 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 o55207-3 361962 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mbp tagged maltose binding protein tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false F2D mint synj2bp-synj2-5 361960 o55207-3 361962 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified mbp tagged maltose binding protein tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 syj2b_rat 361963 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false F2E IC50 21 nanomolar mint synj2-synj2bp-2 361961 syj2b_rat 361963 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 o55207-3 361962 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 colocalization colocalization false false false F8B mint