IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yeh-1997-1 A cyanobacterial phytochrome two-component light sensory system. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Yeh KC., Wu SH., Murphy JT., Lagarias JC. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species fig 3 jclagarias@ucdavis.edu Science (0036-8075) 1997 phy1_syny3 Phytochrome-like protein Cph1 Light-regulated histidine kinase 1 cph1 slr0473 Bacteriophytochrome Cph1 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MATTVQLSDQSLRQLETLAIHTAHLIQPHGLVVVLQEPDLTISQISANCTGILGRSPEDLLGRTLGEVFDSFQIDPIQSRLTAGQISSLNPSKLWARVMGDDFVIFDGVFHRNSDGLLVCELEPAYTSDNLPFLGFYHMANAALNRLRQQANLRDFYDVIVEEVRRMTGFDRVMLYRFDENNHGDVIAEDKRDDMEPYLGLHYPESDIPQPARRLFIHNPIRVIPDVYGVAVPLTPAVNPSTNRAVDLTESILRSAYHCHLTYLKNMGVGASLTISLIKDGHLWGLIACHHQTPKVIPFELRKACEFFGRVVFSNISAQEDTETFDYRVQLAEHEAVLLDKMTTAADFVEGLTNHPDRLLGLTGSQGAAICFGEKLILVGETPDEKAVQYLLQWLENREVQDVFFTSSLSQIYPDAVNFKSVASGLLAIPIARHNFLLWFRPEVLQTVNWGGDPNHAYEATQEDGKIELHPRQSFDLWKEIVRLQSLPWQSVEIQSALALKKAIVNLILRQAEELAQLARNLERSNADLKKFAYIASHDLQEPLNQVSNYVQLLEMRYSEALDEDAKDFIDFAVTGVSLMQTLIDDILTYAKVDTQYAQLTFTDVQEVVDKALANLKQRIEESGAEIEVGSMPAVMADQIQLMQVFQNLIANGIKFAGDKSPKIKIWGDRQEDAWVFAVQDNGIGIDPQFFERIFVIFQRLHTRDEYKGTGMGLAICKKIIEGHQGQIWLESNPGEGSTFYFSIPIGN rcp1_syny3 Response regulator Rcp1 rcp1 slr0474 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSDESNPPKVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDLKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESFWLETVTLPAA cph1-cph1-4 Autophosphorylation of cph1 (Synechocystis PCC6803) 257705 N/A 257706 enzyme target enzyme target substrate substrate unspecified role unspecified role strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q55168:p.His538Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 257706 enzyme enzyme unspecified role unspecified role strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q55168:p.His538Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false histidine kinase required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false The red light-absorbing form (Pr form) of cph1, produced by addition of phycocyanobilin (PCB), exhibited an ATP-dependant autophosphorylation whereas the red light-absorbing form (Pfr form) could not autophosphorylate. cph1 is phosphorylated on a histidine, probably His538 cph1-rcp1-4 Phosphorylation of rcp1 by cph1 (Synechocystis PCC6803) 257705 N/A 257707 enzyme target enzyme target substrate substrate unspecified role unspecified role strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q55169:p.Asp68Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 257706 enzyme enzyme unspecified role unspecified role strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q55168:p.His538Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false The red light-absorbing form (Pr form) of cph1, produced by addition of phycocyanobilin (PCB), exhibited an ATP-dependant autophosphorylation and phosphorylation of rcp1 whereas the far-red light-absorbing form (Pfr form) could not autophosphorylate not phosphorylate. rcp1 is phosphorylated on a histidine