MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint chun-2005-1 The polycomb group gene product Mel-18 interacts with cyclin D2 and modulates its activity. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Chun T., Rho SB., Byun HJ., Lee JY., Kong G. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation chun-2005-2 The polycomb group gene product Mel-18 interacts with cyclin D2 and modulates its activity. yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling predetermined predetermined participant predetermined Chun T., Rho SB., Byun HJ., Lee JY., Kong G. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation chun-2005-3 The polycomb group gene product Mel-18 interacts with cyclin D2 and modulates its activity. yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Chun T., Rho SB., Byun HJ., Lee JY., Kong G. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation chun-2005-4 The polycomb group gene product Mel-18 interacts with cyclin D2 and modulates its activity. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Chun T., Rho SB., Byun HJ., Lee JY., Kong G. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation ccnd2_human G1/S-specific cyclin-D2 CCND2 protein protein human Homo sapiens Human MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL pcgf2_human Polycomb group RING finger protein 2 PCGF2 MEL18 RNF110 ZNF144 DNA-binding protein Mel-18 RING finger protein 110 Zinc finger protein 144 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT ccnd2-pcgf2 218607 ccnd2_human 218611 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 pcgf2_human 218612 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1B BIOSOURCE = CHO homomint mint ccnd2-pcgf2-1 218608 ccnd2_human 218611 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 pcgf2_human 218612 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false NFA homomint mint ccnd2-pcgf2-2 218609 pcgf2_human 218612 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pro/ser rich region Stoichiometry: 1.0 ccnd2_human 218611 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F2 F3 homomint mint ccnd2-pcgf2-3 218610 ccnd2_human cyclin-D2 218611 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 pcgf2_human MEL18 218612 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization false false false F4 homomint mint