IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dharmasiri-2005-2 Plant development is regulated by a family of auxin receptor F box proteins. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dharmasiri N., Dharmasiri S., Weijers D., Lechner E., Yamada M., Hobbie L., Ehrismann JS., Jurgens G., Estelle M. This study used transgenic arabidopsis myc-tagged AFB1 or AFB3 protein expressing constructs and crude plant extracts were obtained and used from these. Figure 1(b). maestell@indiana.edu Dev. Cell (1534-5807) 2005 dharmasiri-2005-1 Plant development is regulated by a family of auxin receptor F box proteins. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dharmasiri N., Dharmasiri S., Weijers D., Lechner E., Yamada M., Hobbie L., Ehrismann JS., Jurgens G., Estelle M. This study used transgenic arabidopsis myc-tagged AFB1 or AFB3 protein expressing constructs and crude plant extracts were obtained and used from these. Figure 1(b). maestell@indiana.edu Dev. Cell (1534-5807) 2005 iaa7_arath Auxin-responsive protein IAA7 Indoleacetic acid-induced protein 7 Auxin resistant 2 IAA7 AXR2 At3g23050 MXC7.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS grh1_arath GRR1-like protein 1 Protein AUXIN SIGNALING F-BOX 1 GRH1 AFB1 FBL18 GER1 LRF1 F4C21.11 At4g03190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLRFPPKVLEHILSFIDSNEDRNSVSLVCKSWFETERKTRKRVFVGNCYAVSPAAVTRRFPEMRSLTLKGKPHFADYNLVPDGWGGYAWPWIEAMAAKSSSLEEIRMKRMVVTDECLEKIAASFKDFKVLVLTSCEGFSTDGIAAIAATCRNLRVLELRECIVEDLGGDWLSYFPESSTSLVSLDFSCLDSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLVSLLRCAPQLTELGTGSFAAQLKPEAFSKLSEAFSNCKQLQSLSGLWDVLPEYLPALYSVCPGLTSLNLSYATVRMPDLVELLRRCSKLQKLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDLDATNIPLTEQGLVFVSKGCRKLESVLYFCVQFTNAALFTIARKRPNLKCFRLCVIEPFAPDYKTNEPLDKGFKAIAEGCRDLRRLSVSGLLSDKAFKYIGKHAKKVRMLSIAFAGDSDLMLHHLLSGCESLKKLEIRDCPFGDTALLEHAAKLETMRSLWMSSCFVSFGACKLLSQKMPRLNVEVIDEHPPESRPESSPVERIYIYRTVAGPRMDTPEFVWTIHKNPENGVSHLAIK afb3_arath Protein AUXIN SIGNALING F-BOX 3 AFB3 F13K23.7 At1g12820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNYFPDEVIEHVFDFVASHKDRNSISLVCKSWHKIERFSRKEVFIGNCYAINPERLIRRFPCLKSLTLKGKPHFADFNLVPHEWGGFVHPWIEALARSRVGLEELRLKRMVVTDESLDLLSRSFANFKSLVLVSCEGFTTDGLASIAANCRHLRELDLQENEIDDHRGQWLNCFPDSCTTLMSLNFACLKGETNVAALERLVARSPNLKSLKLNRAVPLDALARLMSCAPQLVDLGVGSYENEPDPESFAKLMTAIKKYTSLRSLSGFLEVAPLCLPAFYPICQNLISLNLSYAAEIQGNHLIKLIQLCKRLQRLWILDSIGDKGLAVVAATCKELQELRVFPSDVHGEEDNNASVTEVGLVAISAGCPKLHSILYFCKQMTNAALIAVAKNCPNFIRFRLCILEPHKPDHITFQSLDEGFGAIVQACKGLRRLSVSGLLTDQVFLYIGMYAEQLEMLSIAFAGDTDKGMLYVLNGCKKMRKLEIRDSPFGNAALLADVGRYETMRSLWMSSCEVTLGGCKRLAQNSPRLNVEIINENENNGMEQNEEDEREKVDKLYLYRTVVGTRKDAPPYVRIL afb2_arath Protein AUXIN SIGNALING F-BOX 2 AFB2 LRF2 MDJ14.12 At3g26810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNYFPDEVIEHVFDFVTSHKDRNAISLVCKSWYKIERYSRQKVFIGNCYAINPERLLRRFPCLKSLTLKGKPHFADFNLVPHEWGGFVLPWIEALARSRVGLEELRLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQENEIDDHRGQWLSCFPDTCTTLVTLNFACLEGETNLVALERLVARSPNLKSLKLNRAVPLDALARLMACAPQIVDLGVGSYENDPDSESYLKLMAVIKKCTSLRSLSGFLEAAPHCLSAFHPICHNLTSLNLSYAAEIHGSHLIKLIQHCKKLQRLWILDSIGDKGLEVVASTCKELQELRVFPSDLLGGGNTAVTEEGLVAISAGCPKLHSILYFCQQMTNAALVTVAKNCPNFIRFRLCILEPNKPDHVTSQPLDEGFGAIVKACKSLRRLSLSGLLTDQVFLYIGMYANQLEMLSIAFAGDTDKGMLYVLNGCKKMKKLEIRDSPFGDTALLADVSKYETMRSLWMSSCEVTLSGCKRLAEKAPWLNVEIINENDNNRMEENGHEGRQKVDKLYLYRTVVGTRMDAPPFVWIL iaa12_arath Auxin-responsive protein IAA12 Indoleacetic acid-induced protein 12 Protein BODENLOS IAA12 BDL At1g04550 T1G11.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGVSELEVGKSNLPAESELELGLGLSLGGGAWKERGRILTAKDFPSVGSKRSAESSSHQGASPPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQGLGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGSSDFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQRNNPV tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA afb1-iaa7 Pull down assay reveals in vivo interaction between AFB1 protein and IAA7 protein. 195676 N/A 195678 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 195679 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false This interaction was stimulated by auxin. afb3-iaa7 Pull down assay reveals in vivo interaction between AFB3 protein and IAA7 protein. 195676 N/A 195678 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 195680 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false This interaction was stimulated by auxin. afb2-iaa7 Pull down assay reveals in vivo interaction between AFB2 protein and IAA7 protein. 195676 N/A 195681 unspecified role unspecified role prey prey N/A 195678 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false This interaction is stimulated by the presence of auxin. afb1-iaa12 Pull down assay reveals in vivo interaction between AFB1 protein and IAA12 protein. 195676 N/A 195679 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 195682 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q38830:p.Pro74Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false This interaction was stimulated by auxin. The Pro72Ser mutation abolishes interaction between the proteins. afb3-iaa12 Pull down assay reveals in vivo interaction between AFB3 protein and IAA12 protein. 195676 N/A 195682 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q38830:p.Pro74Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 195680 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false This interaction was stimulated by auxin. The Pro72Ser mutation abolishes ineteraction between the proteins. tir1-iaa12 Pull down assay reveals in vivo interaction between TIR1 protein and IAA12 protein. 195676 N/A 195683 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 195682 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q38830:p.Pro74Ser Pro72Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false This interaction was stimulated by auxin. The Pro72Ser mutation abolishes interaction between the proteins. afb1-cul1 Anti tag CoIPassay reveals in vivo interaction between AFB1 protein, Cullin1 protein and the ASK1 protein 195677 N/A 195679 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 195684 unspecified role unspecified role prey prey N/A 195685 unspecified role unspecified role prey prey association association false false false afb3-cul1 Anti tag CoIP assay reveals in vivo interaction between AFB3 protein, Cullin1 protein and the ASK1 protein 195677 N/A 195680 unspecified role unspecified role bait bait myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 195684 unspecified role unspecified role prey prey N/A 195685 unspecified role unspecified role prey prey association association false false false