MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url&gt;http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint riekenberg-2005-1 Identification of EhICP1, a chagasin-like cysteine protease inhibitor of Entamoeba histolytica. in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Riekenberg S., Witjes B., Sarić M., Bruchhaus I., Scholze H. FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation icp1_enthi Amoebiasin-1 AMS ICP1 Cysteine protease inhibitor 1 EhICP1 protein protein enthi Entamoeba histolytica MSLTEDNNNTTITIAKGENKEIILHGNPTTGYSWVVDSCEGLSNTVEYVADQHAPGICGCGGKYHIKITGTQTGEGKIVLVYRRPWAPNANDRTFTLKVNVQ mint May serve to protect the cytosol against cysteine protease molecules released by damaged intracellular vesicles. Inhibits papain and soluble trophozoite extract ams-ams 176299 icp1_enthi 176300 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 icp1_enthi 176300 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 association association false false false F4B experimantal=gel overlay<br><br><br><br> mint