IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gonzales-2005-2 Characterization of Saccharomyces cerevisiae Nop17p, a novel Nop58p-interacting protein that is involved in Pre-rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gonzales FA., Zanchin NI., Luz JS., Oliveira CC. J. Mol. Biol. (0022-2836) 2005 gonzales-2005-1 Characterization of Saccharomyces cerevisiae Nop17p, a novel Nop58p-interacting protein that is involved in Pre-rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gonzales FA., Zanchin NI., Luz JS., Oliveira CC. J. Mol. Biol. (0022-2836) 2005 gonzales-2005-3 Characterization of Saccharomyces cerevisiae Nop17p, a novel Nop58p-interacting protein that is involved in Pre-rRNA processing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Gonzales FA., Zanchin NI., Luz JS., Oliveira CC. J. Mol. Biol. (0022-2836) 2005 gonzales-2005-4 Characterization of Saccharomyces cerevisiae Nop17p, a novel Nop58p-interacting protein that is involved in Pre-rRNA processing. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gonzales FA., Zanchin NI., Luz JS., Oliveira CC. J. Mol. Biol. (0022-2836) 2005 prm4_yeast Pheromone-regulated membrane protein 4 PRM4 P2578 YPL156C protein protein yeast Saccharomyces cerevisiae Baker's yeast MIADSSVLKKHTAIKRSTRIISLTLVLLGVFSFLLLTWNDSLEFYNSADPSENKKNSEEESEKKFVYKLPNLLKTADSFLSNENELNFQKVKEEISNIQSEVEVDIPEPSSKATSKFSSRSFQTDNVVTATTTTTLNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATVDLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEPHSKGLLLPLLKSEARGNLLVEKKDIPSNS pih1_yeast Protein interacting with Hsp90 1 PIH1 NOP17 Nucleolar protein 17 YHR034C protein protein yeast Saccharomyces cerevisiae Baker's yeast MADFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSANGPEKLQDGRKVFINVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDELHQDYKAKMHKIIEEEAGDPMSILRGRNDDGDDNNDPDDGTLPPLFPIENKISGAKIEEIDKNEIAHRNLKQAPAPAPAPHEQQEDVPEYEVKMKRFKGAAYKLRILIENKAPNSKPDRFSPSYNFAENILYINGKLSIPLPRDIVVNAADIKIFHIRKERTLYIYI 02C06D0A113B1B3B snu13_yeast 13 kDa ribonucleoprotein-associated protein YEL026W SNU13 Small nuclear ribonucleoprotein-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI 4489780153E8F182 fbrl_yeast rRNA 2'-O-methyltransferase fibrillarin NOP1 LOT3 YDL014W D2870 U3 small nucleolar RNA-associated protein NOP1 Histone-glutamine methyltransferase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMRSGLKK 56A8B958A7B6066E nop56_yeast Nucleolar protein 56 SIK1 Ribosome biosynthesis protein SIK1 YLR197W L8167.9 NOP56 Suppressor of I kappa b protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKPTLKNELAIQEAMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKKDKKEKKDKKKKSKD F8522A5870EF4842 rrp43_yeast Exosome complex component RRP43 RRP43 YCR035C YCR35C YCR522 Ribosomal RNA-processing protein 43 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAESTTLETIEIHPITFPPEVLARISPELSLQRHLSLGIRPCLRKYEEFRDVAIENNTLSRYADAGNIDTKNNILGSNVLKSGKTIVITSITGGIIEETSAAIKDLDDFGEEELFEVTKEEDIIANYASVYPVVEVERGRVGACTDEEMTISQKLHDSILHSRILPKKALKVKAGVRSANEDGTFSVLYPDELEDDTLNETNLKMKRKWSYVLYAKIVVLSRTGPVFDLCWNSLMYALQSVKLPRAFIDERASDLRMTIRTRGRSATIRETYEIICDQTKSVPLMINAKNIAFASNYGIVELDPECQLQNSDNSEEEEVDIDMDKLNTVLIADLDTEAEETSIHSTISILAAPSGNYKQLTLVGGGAKITPEMIKRSLLLSRVRADDLSTRFNI 8801837B8184134D nop17-nop58-1 Interaction detected by yeast two hybrid 180561 N/A 180565 unspecified role unspecified role prey prey N/A 180566 unspecified role unspecified role bait bait physical association physical association false false false nop1-snu13 Interaction detected by yeast two hybrid 180561 N/A 180567 unspecified role unspecified role prey prey N/A 180568 unspecified role unspecified role bait bait physical association physical association false false false nop58-snu13 Interaction detected by yeast two hybrid 180561 N/A 180567 unspecified role unspecified role prey prey N/A 180565 unspecified role unspecified role bait bait physical association physical association false false false nop56-snu13 Interaction detected by yeast two hybrid 180561 N/A 180567 unspecified role unspecified role prey prey N/A 180569 unspecified role unspecified role bait bait physical association physical association false false false nop56-nop1 Interaction detected by yeast two hybrid 180561 N/A 180569 unspecified role unspecified role bait bait N/A 180568 unspecified role unspecified role prey prey physical association physical association false false false snu13-nop1 Interaction detected by yeast two hybrid 180561 N/A 180567 unspecified role unspecified role bait bait N/A 180568 unspecified role unspecified role prey prey physical association physical association false false false nop17-rrp43 Interaction detected by yeast two hybrid 180562 N/A 180566 unspecified role unspecified role bait bait N/A 180570 unspecified role unspecified role prey prey physical association physical association false false false nop17-nop58 Interaction detected by yeast two hybrid 180562 N/A 180566 unspecified role unspecified role bait bait N/A 180565 unspecified role unspecified role prey prey c-terminus C-terminus region (217-511) of Nop58 binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false rrp43-nop17 Interaction detected by his pull-down 180563 N/A 180566 unspecified role unspecified role prey prey n-terminus N-terminus protein A-tagged protein Nop17 tag tag certain certain sequence position certain certain certain sequence position certain false N/A 180570 unspecified role unspecified role bait bait n-terminus N-terminus HIS tagged protein Rrp43 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false nop17-nop58-2 Interaction detected by coimmunoprecipitation 180564 N/A 180566 unspecified role unspecified role prey prey n-terminus N-terminus GST-tagged protein Nop17 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 180565 unspecified role unspecified role bait bait n-terminus N-terminus protein A-tagged protein Nop58 tag tag certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false