IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sergeant-2005-1 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Sergeant J., Taylor E., Palecek J., Fousteri M., Andrews EA., Sweeney S., Shinagawa H., Watts FZ., Lehmann AR. Fig. 3A,B, 6A,B Mol. Cell. Biol. (0270-7306) 2005 sergeant-2005-2 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sergeant J., Taylor E., Palecek J., Fousteri M., Andrews EA., Sweeney S., Shinagawa H., Watts FZ., Lehmann AR. Fig. 3A,B, 6A,B Mol. Cell. Biol. (0270-7306) 2005 sergeant-2005-6 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sergeant J., Taylor E., Palecek J., Fousteri M., Andrews EA., Sweeney S., Shinagawa H., Watts FZ., Lehmann AR. Prey proteins were radiolabelled and identified using a phosphoimager Fig. 3A,B, 6A,B Mol. Cell. Biol. (0270-7306) 2005 sergeant-2005-7 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Sergeant J., Taylor E., Palecek J., Fousteri M., Andrews EA., Sweeney S., Shinagawa H., Watts FZ., Lehmann AR. The S-tagged proteins were prebound to protein S beads, unlike in Sergeant-2005-1 Fig. 3A,B, 6A,B Mol. Cell. Biol. (0270-7306) 2005 sergeant-2005-5 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sergeant J., Taylor E., Palecek J., Fousteri M., Andrews EA., Sweeney S., Shinagawa H., Watts FZ., Lehmann AR. Fig. 3A,B, 6A,B Mol. Cell. Biol. (0270-7306) 2005 sergeant-2005-3 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Sergeant J., Taylor E., Palecek J., Fousteri M., Andrews EA., Sweeney S., Shinagawa H., Watts FZ., Lehmann AR. Hsp70 contaminated the initial precipitation. It was removed via washing with ant-myc beads with ATP. Fig. 3A,B, 6A,B Mol. Cell. Biol. (0270-7306) 2005 sergeant-2005-4 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sergeant J., Taylor E., Palecek J., Fousteri M., Andrews EA., Sweeney S., Shinagawa H., Watts FZ., Lehmann AR. Fig. 3A,B, 6A,B Mol. Cell. Biol. (0270-7306) 2005 smc5_schpo Structural maintenance of chromosomes protein 5 smc5 SMC partner of rad18 DNA repair protein spr18 spr18 SPAC14C4.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDGLRPSKRRKSNPLYSDYALGSIVRIKLVNFVTYDYCELFPGPYLNLIIGPNGTGKSTIVSAICIGLGWPPKLLGRAKEAREFIKYGKNTATIEIEMKYRDDETVTITRQISQDKSSSFSINREACATSSITSLMDTFNVQLNNLCHFLPQDRVAEFAQLDPYSRLMETERAIDHEGLLPAHEKLIDLRKREREILQNKNQGQSTLNSLKDRQQALEKEVNIFKEREKIKSYIEMLGLAKMLVIYREKTNVFNQLRADKKKLKKDLKDLVEEFQPILDKGEELRSDLKLKDDTFNDYSSASMELNTSNLRARASFSNFMENEKKLYEKVNTNRTLLRNANLTLNEAQQSVKSLTERQGPRPSDNGVQDLQEKMQEVNAEKLQHENEKLESSHELGSIRTLKAQKLIDLDNIKRELSYYNDATKRKLDFMSSAPGWEDAYQTYQLLKEYESAFEAPAYGPIYMNLKCKEKGFAALIEGFFRTDTFRTFIMSNYNDYLKLMDLITSKTKYTPTIREFSSERKKKIEDFEPPCSREKLQSFGFDGYVIDFLEGPEVVLVALCHMLKIHQIPIAKRELPPASVNALNNFRLANGDPVLKTYLAGSSIHLVFRSAYGDREITRRTDPLPSRSIYFSENVEMDLVKRKEEQLNAQLSQLENLQNEERKLQEKVNEHESLLSRTNDILSTLRKERDEKLIPIHEWQQLQERIEHQTLLLRQREKVPEQFAAEIEKNEDIRKENFEALMNSVLKVKENSIKATNNFEKMLGSRLNVIEAKYKLEKHEMDANQVNARLTEVQDRLKDITDKLASAREDAMSLYGSVVDSLQTQSSDRQTAITELNEEFATSSEVDNKISIEETKLKFMNVNSYVMEQYDARKKEIEELESKMSDFDQSVEELQDEMNSIKEDWVSKLEENVQCISDRFSKGMSGMGYAGEVRLGKSDDYDKWYIDILVQFREEEGLQKLTGQRQSGGERSVSTIMYLLSLQGLAIAPFRIVDEINQGMDPRNERVVHRHIVNSVCDNAVSQYFLVTPKLLPDLTYHRNLKVLCICNGAWLPATFRTSLSTYFEKLKKSALISSS smc6_schpo Structural maintenance of chromosomes protein 6 smc6 SPCC5E4.06 DNA repair protein rad18 rad18 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTTELTNVSLEEAITEKTSENRRKRDSDVLQTEEVDLSNVKRIRASRNQDNRPERQSRLQRSSSLIEQVRGNEDGENDVLNQTRETNSNFDNRVGVIECIHLVNFMCHDSLKINFGPRINFVIGHNGSGKSAILTGLTICLGAKASNTNRAPNMKSLVKQGKNYARISVTISNRGFEAYQPEIYGKSITIERTIRREGSSEYRLRSFNGTVISTKRDELDNICDHMGLQIDNPMNILTQDTARQFLGNSSPKEKYQLFMKGIQLKQLEENYSLIEQSLINTKNVLGNKKTGVSYLAKKEEEYKLLWEQSRETENLHNLLEQKKGEMVWAQVVEVEKELLLAEKEFQHAEVKLSEAKENLESIVTNQSDIDGKISSKEEVIGRAKGETDTTKSKFEDIVKTFDGYRSEMNDVDIQKRDIQNSINAAKSCLDVYREQLNTERARENNLGGSQIEKRANESNNLQREIADLSEQIVELESKRNDLHSALLEMGGNLTSLLTKKDSIANKISDQSEHLKVLEDVQRDKVSAFGKNMPQLLKLITRETRFQHPPKGPMGKYMTVKEQKWHLIIERILGNVINGFIVRSHHDQLILKELMRQSNCHATVVVGKYDPFDYSSGEPDSQYPTVLKIIKFDDDEVLHTLINHLGIEKMLLIEDRREAEAYMKRGIANVTQCYALDPRNRGYGFRIVSTQRSSGISKVTPWNRPPRIGFSSSTSIEAEKKILDDLKKQYNFASNQLNEAKIEQAKFKRDEQLLVEKIEGIKKRILLKRREVNSLESQELSVLDTEKIQTLERRISETEKELESYAGQLQDAKNEEHRIRDNQRPVIEEIRIYREKIQTETQRLSSLQTELSRLRDEKRNSEVDIERHRQTVESCTNILREKEAKKVQCAQVVADYTAKANTRCERVPVQLSPAELDNEIERLQMQIAEWRNRTGVSVEQAAEDYLNAKEKHDQAKVLVARLTQLLQALEETLRRRNEMWTKFRKLITLRTKELFELYLSQRNFTGKLVIKHQEEFLEPRVYPANRNLATAHNRHEKSKVSVQGLSGGEKSFATICMLLSIWEAMSCPLRCLDEFDVFMDAVNRLVSIKMMVDSAKDSSDKQFIFITPQDMGQIGLDKDVVVFRLSDPVVSSSALPPSTAP nse3_schpo Non-structural maintenance of chromosome element 3 SPCC645.04 nse3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSQLSFTGKSSSKGRSRLTQEVRPTASQIIADEEASDLDEYEEDLEGSGNEDDFGPSMSRSSRGRKRRKGDPLELQSQFEERNETDAINFQLLVRNVVRYAICSQTSHNTITRKDIVQKAFPEGTSRNLFQSVFEEADRQLQLSFGFRLVAVTQSNRKKDMAVSQLRRPATSNANSSNLHRYWVLRSTLPMELQKDSRLIVDSVLDTAYYGFLMTVIAFIAVSHCSVGHSELQSFLQELLTEEETTPLHLDITRSLSLLVRQGYLDRVKDDTHNQFVYYIGSRAVTEISIEGLKSFVTEFFPDSDIDMDALLTEYRQEYQNQSSSSAA nse1_schpo Non-structural maintenance of chromosomes element 1 nse1 SPCC550.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEKERQDGLSDKHKFILQYIMCRTAGVDNEQVRELVQEQYGETATVEDVINELNNSLHNFDFKIKRVQDQLDGRLTLHFQNLSGDPVSQMATPYPPVQIELMRKIIEWIMKCDDYQYSLTTLQIQKLSRKEMGLAPSVIESHLHTFERDGWLRQREGIWTFTNHALAELDAYLHNEYESNLYECNACREIVIAGYVCDCGYCLHVYCCKHLAHVNCINCNTPWANATVIGRW smc6_human Structural maintenance of chromosomes protein 6 SMC6 SMC6L1 protein protein human Homo sapiens Human MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFVKDGQNSADISITLRNRGDDAFKASVYGNSILIQQHISIDGSRSYKLKSATGSVVSTRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYSYIMETKERTKEQIHQGEERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAWAVVNEIEKQLNAIRDNIKIGEDRAARLDRKMEEQQVRLNEAEQKYKDIQDKLEKISEETNARAPECMALKADVVAKKRAYNEAEVLYNRSLNEYKALKKDDEQLCKRIEELKKSTDQSLEPERLERQKKISWLKERVKAFQNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHADERVLQALMKRFYLPGTSRPPIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKPPKNCREAFTADGDQVFAGRYYSSENTRPKFLSRDVDSEISDLENEVENKTAQILNLQQHLSALEKDIKHNEELLKRCQLHYKELKMKIRKNISEIRELENIEEHQSVDIATLEDEAQENKSKMKMVEEHMEQQKENMEHLKSLKIEAENKYDAIKFKINQLSELADPLKDELNLADSEVDNQKRGKRHYEEKQKEHLDTLNKKKRELDMKEKELEEKMSQARQICPERIEVEKSASILDKEINRLRQKIQAEHASHGDREEIMRQYQEARETYLDLDSKVRTLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNFDHKNETLSISVQPGEGNKAAFNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVYMDMVNRRIAMDLILKMADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQEEDDDQR smc5_human Structural maintenance of chromosomes protein 5 SMC5 KIAA0594 SMC5L1 protein protein human Homo sapiens Human MATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMENFLTYDICEVSPGPHLNMIVGANGTGKSSIVCAICLGLAGKPAFMGRADKVGFFVKRGCSRGMVEIELFRASGNLVITREIDVAKNQSFWFINKKSTTQKIVEEKVAALNIQVGNLCQFLPQDKVGEFAKLSKIELLEATEKSIGPPEMHKYHCELKNLREKEKQLETSCKEKTEYLQKMVQRNERYKQDVERFYERKRHLDLIEMLEAKRPWVEYENVRQEYEEVKLVRDRVKEEVRKLKEGQIPVTCRIEEMENERHNLEARIKEKATDIKEASQKCKQKQDVIERKDKHIEELQQALIVKQNEELDRQRRIGNTRKMIEDLQNELKTTENCENLQPQIDAITNDLRRIQDEKALCEGEIIDKRRERETLEKEKKSVDDHIVRFDNLMNQKEDKLRQRFRDTYDAVLWLRNNRDKFKQRVCEPIMLTINMKDNKNAKYIENHIPSNDLRAFVFESQEDMEVFLKEVRDNKKLRVNAVIAPKSSYADKAPSRSLNELKQYGFFSYLRELFDAPDPVMSYLCCQYHIHEVPVGTEKTRERIERVIQETRLKQIYTAEEKYVVKTSFYSNKVISSNTSLKVAQFLTVTVDLEQRRHLEEQLKEIHRKLQAVDSGLIALRETSKHLEHKDNELRQKKKELLERKTKKRQLEQKISSKLGSLKLMEQDTCNLEEEERKASTKIKEINVQKAKLVTELTNLIKICTSLHIQKVDLILQNTTVISEKNKLESDYMAASSQLRLTEQHFIELDENRQRLLQKCKELMKRARQVCNLGAEQTLPQEYQTQVPTIPNGHNSSLPMVFQDLPNTLDEIDALLTEERSRASCFTGLNPTIVQEYTKREEEIEQLTEELKGKKVELDQYRENISQVKERWLNPLKELVEKINEKFSNFFSSMQCAGEVDLHTENEEDYDKYGIRIRVKFRSSTQLHELTPHHQSGGERSVSTMLYLMALQELNRCPFRVVDEINQGMDPINERRVFEMVVNTACKENTSQYFFITPKLLQNLPYSEKMTVLFVYNGPHMLEPNTWNLKAFQRRRRRITFTQPS nse4_schpo Non-structural maintenance of chromosome element 4 nse4 rad62 SPBC20F10.04c DNA repair protein rad62 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSIDKRDLRKRYRNLINKVQESRLELVDEENNNLYETITTANDLFSSVDAPTEATLDALLLTKTVDLASIKARQLHIGRPKFNIELFTKNIKQFLNYPTSHSNVTRIQEIDTAWSRLGKLASNCEKQPASLNLMVGPLSFRKKERNIQRRERLQKAPNVLTQPTMLNERNITTQENNTTKNVLHISRLLQAHQPVNFLKFITNPQSYPQTVENLFYVSFLFKEGKAALVENESGILMLETRIPPTDDQVVAGEIRNIQLVLDMTMDLYENIIKEYNIKESIIPTRAPVETSTNSNTWYG nse2_schpo E3 SUMO-protein ligase nse2 nse2 SPAC16A10.06c E3 SUMO-protein transferase nse2 pli2 Non-structural maintenance of chromosomes element 2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSEAQLKTSLEALSQNLLPGNQNHCSFDFQLKEIDDSIKQVIKCALVAAEIKNNECLDMLDSGIRELLDAKQRLLLMQQSVDTLANKTSENISDFENKSLLDIYTQIFKELIQEYEEKSDYGKYGTQGEYIEFKKTIWHEQNTDGSDFPSMKTFFNVMNTEEQEADEVMVYSATFDNRCPLTLQPIVHPILSTACNHFYEKDAILSLLNPTCVCPVVGCEARLQRSLLKEDEILERRLRRAQEISNLKEA smc6-smc5-3 Smc6 (bait) interaction with smc5 (prey) via pull-down with myc-tag 189711 N/A 189718 unspecified role unspecified role prey prey O13710:p.Gly540Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 189719 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false smc5-smc6-3 Smc5 (bait) interaction with smc6 (prey) via pull-down with myc-tag 189711 N/A 189719 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 189718 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O13710:p.Gly540Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false nse1-nse3-1 Nse1 (bait) interaction with nse3 (prey) via pull-down with GST-tag 189711 N/A 189720 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 189721 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false nse3-nse1-1 Nse3 (bait) interaction with nse1 (prey) via pull-down with GST-tag 189711 N/A 189720 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 189721 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false nse3-nse1-2 Nse3 (bait) interaction with nse1 (prey) 189711 N/A 189721 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 189720 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false nse3-nse1-3 Nse3 (bait) interaction with nse1 (prey) 189711 N/A 189720 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 189721 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false smc5-nse3-1 Smc5 (bait) interaction with nse3 Y2H 189712 N/A 189718 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 189720 unspecified role unspecified role prey prey physical association physical association false false false Weak interaction smc5-smc6-2 Interaction in the hinge region between human smc5 and smc6 189712 N/A 189722 unspecified role unspecified role prey prey Q96SB8:p.Gly506Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false hinge region binding region binding-associated region binding region range range range range false N/A 189723 unspecified role unspecified role bait bait hinge region binding region binding-associated region binding region range range range range false physical association physical association false false false The interaction experiment in the hinge region was done using fragments and the authors didn't quote the residue numbers. The hinge region given has been estimated via alignment with the Sch. pombe smc5 and smc6 sequences to the corresponding human sequences and the subsequent mapping of the residues. nse4-nse3-1 Nse4 (bait) interaction with nse3 (prey) via yeast two hybrid 189712 N/A 189724 unspecified role unspecified role bait bait N/A 189720 unspecified role unspecified role prey prey physical association physical association false false false nse2-nse3-1 Nse2 (bait) interaction with nse3 (prey) via yeast two hybrid 189712 N/A 189720 unspecified role unspecified role prey prey N/A 189725 unspecified role unspecified role bait bait physical association physical association false false false smc5-nse2-1 Smc5 (bait) interaction with nse2 (prey) 189713 N/A 189725 unspecified role unspecified role bait bait s-tag region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 189718 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false nse2-smc5-1 Nse2 (bait) interaction with smc5 (prey) 189713 N/A 189725 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 189718 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false nse2-smc5-3 Nse2 (bait) interaction with smc5 (prey) 189713 N/A 189718 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 189725 unspecified role unspecified role bait bait s-tagged region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false nse4-nse1-2 Nse4 (bait) interaction with nse1 (prey) 189714 N/A 189721 unspecified role unspecified role prey prey in vitro In vitro N/A 189724 unspecified role unspecified role bait bait s-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false nse4-nse3-3 Nse4 (bait) interaction with nse3(prey) and nse1 (prey) 189714 N/A 189721 unspecified role unspecified role prey prey in vitro In vitro N/A 189720 unspecified role unspecified role prey prey in vitro In vitro N/A 189724 unspecified role unspecified role bait bait s-tag region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false nse4-nse3-4 Nse4 (bait) interaction with nse3(prey) 189714 N/A 189724 unspecified role unspecified role bait bait s-tag region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 189720 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false smc6-nse3-3 Interactions within the Smc5-smc6 complex in Schizosaccharomyces pombe 189715 N/A 189720 unspecified role unspecified role prey prey N/A 189719 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false smc6-nse3-4 Interactions within the Smc5-smc6 complex in Schizosaccharomyces pombe 189715 N/A 189719 unspecified role unspecified role prey prey N/A 189720 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false smc6-nse2-1 Interactions within the Smc5-smc6 complex in Schizosaccharomyces pombe 189716 N/A 189719 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 189721 unspecified role unspecified role prey prey N/A 189718 unspecified role unspecified role prey prey N/A 189724 unspecified role unspecified role prey prey N/A 189720 unspecified role unspecified role prey prey N/A 189725 unspecified role unspecified role prey prey association association false false false smc6-nse1-2 Interactions within the Smc5-smc6 complex in Schizosaccharomyces pombe 189717 n/a 189725 unspecified role unspecified role prey prey N/A 189718 unspecified role unspecified role prey prey N/A 189724 unspecified role unspecified role prey prey N/A 189720 unspecified role unspecified role prey prey N/A 189719 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 189721 unspecified role unspecified role prey prey association association false false false