IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tzfira-2004-1 Involvement of targeted proteolysis in plant genetic transformation by Agrobacterium. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tzfira T., Vaidya M., Citovsky V. ttzfira@ms.cc.sunysb.edu Nature (0028-0836) 2004 tzfira-2004-2 Involvement of targeted proteolysis in plant genetic transformation by Agrobacterium. tobac Nicotiana tabacum (Common tobacco) Common tobacco bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Tzfira T., Vaidya M., Citovsky V. ttzfira@ms.cc.sunysb.edu Nature (0028-0836) 2004 tzfira-2004-3 Involvement of targeted proteolysis in plant genetic transformation by Agrobacterium. allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Tzfira T., Vaidya M., Citovsky V. ttzfira@ms.cc.sunysb.edu Nature (0028-0836) 2004 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE virf_agrt9 Protein VirF virF protein protein agrt9 Agrobacterium tumefaciens (strain 15955) MRNSSLRDASGSNDAQVPHKTELLNLPDHVLTEVAKRLATNNPVESAENIANFSKSHRFTRDAVRTEPLEKFSSRLKILSRNAKLLSHAVRHAATLPDGEQLSEAQLSQMRSEVATRPVLGVAYTHQDGQPEERLSGNHLDHKINNIPNLVFNVAEPIMFNEISALEVMAEVRPIARSIKTAHDDARAELMSADRPRSTRGL vip1_arath Transcription factor VIP1 BZIP51 VIP1 SUE3 Protein SULPHATE UTILIZATION EFFICIENCY 3 VirE2-interacting protein 1 bZIP transcription factor 51 F2J6.6 At1g43700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGGGRGPNQTILSEIEHMPEAPRQRISHHRRARSETFFSGESIDDLLLFDPSDIDFSSLDFLNAPPPPQQSQQQPQASPMSVDSEETSSNGVVPPNSLPPKPEARFGRHVRSFSVDSDFFDDLGVTEEKFIATSSGEKKKGNHHHSRSNSMDGEMSSASFNIESILASVSGKDSGKKNMGMGGDRLAELALLDPKRAKRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSELNTENKHLKMRLQALEQQAELRDALNEALRDELNRLKVVAGEIPQGNGNSYNRAQFSSQQSAMNQFGNKTNQQMSTNGQPSLPSYMDFTKRG vire1_rhird Protein virE1 virE1 protein protein rhird Rhizobium radiobacter (Agrobacterium tumefaciens) Agrobacterium radiobacter Agrobacterium tumefaciens MAIIKPHANKNRTTSPIERPESLIEEMSGSNPPIGFTSLDLAMIELEDFVHRCPLPGDNLAGQKE vire2_agrt9 Single-strand DNA-binding protein virE2 protein protein agrt9 Agrobacterium tumefaciens (strain 15955) MDLSGNEKSRPWKKANVSSSTISDIQMTNGENLESGSPTRTEVLSPRLDDGSVDSSSSLYSGSEHGNQAEIQKELSALFSNMSLPGNDRRPDEYILVRQTGQDAFTGIAKGNLDHMPTKAEFNACCRLYRDGAGNYYPPPLAFDKISVPAQLEETWGMMEAKERNKLRFQYKLDVWNHAHADMGITGTEIFYQTDKNIKLDRNYKLRPEDRYVQTERYGRREIQKRYQHELQAGSLLPDIMIKTPKNDIHFVYRFAGDNYANKQFSEFEHTVKRRYGGETEIKLKSKSGIMHDSKYLESWERGSADIRFAEFVGENRAHNRQFPTATVNMGQQPDGQGGLTRDRHVSVEFLMQSAPNSPWAQALKKGELWDRVQLLARDGNRYLSPHRLEYSDPEHFTELMNRVGLPASMGRQSHAASIKFEKFDAQAAVIVINGPELRDIHDLSPENLQNVSTKDVIVADRNENGQRTGTYTSVAEYERLQLRLPADAAGVLGEAADKYSRDFVRPEPASRPISDSRRIYESRPRSQSVNSF virf-ask1 Yeast 2 hybrid analysis reveals interaction between the VirF protein of Agrobacterium tunifaciens and the ASK1 protein 190957 N/A 190960 unspecified role unspecified role prey prey N/A 190961 unspecified role unspecified role bait bait physical association physical association false false false virf-vip1 Yeast 2 hybrid analysis reveals interaction between the VirF protein of Agrobacterium tunifaciens and the VIP1 protein 190957 N/A 190962 unspecified role unspecified role prey prey N/A 190961 unspecified role unspecified role bait bait physical association physical association false false false vire2-vire2 Yeast 2 hybrid analysis reveals homodimer formation of the VirE2 protein of Agrobacterium tumifaciens. 190957 N/A 190963 unspecified role unspecified role bait bait N/A 190963 unspecified role unspecified role prey prey physical association physical association false false false vip1-vire2 Flourescent complementation analysis reveals interaction between the VIP1 protein and the VirE2 protein 190958 N/A 190964 unspecified role unspecified role neutral component neutral component cyfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190962 unspecified role unspecified role neutral component neutral component nyfp N terminal yellow flourescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false virf-vip1-1 Flourescent complementation analysis reveals interaction between the VirF protein of Agrobacterium tunifaciens and the VIP1 protein 190958 N/A 190962 unspecified role unspecified role neutral component neutral component nyfp N terminal yellow flourescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190961 unspecified role unspecified role neutral component neutral component cyfp C terminal yellow flourescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false vip1-vire2-1 Flourescent complementation analysis reveals interaction between the VIP1 protein and the VirE2 protein 190959 N/A 190964 unspecified role unspecified role neutral component neutral component cyfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190962 unspecified role unspecified role neutral component neutral component nyfp N terminal yellow flourescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false virf-vip1-2 Flourescent complementation analysis reveals interaction between the VirF protein of Agrobacterium tunifaciens and the VIP1 protein 190959 N/A 190962 unspecified role unspecified role neutral component neutral component nyfp N terminal yellow flourescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 190961 unspecified role unspecified role neutral component neutral component cyfp C terminal yellow flourescent protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false