IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ myre-2004-1 Dictyostelium calcium-binding protein 4a interacts with nucleomorphin, a BRCT-domain protein that regulates nuclear number. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Myre MA., O'Day DH. Biochem. Biophys. Res. Commun. (0006-291X) 2004 myre-2004-2 Dictyostelium calcium-binding protein 4a interacts with nucleomorphin, a BRCT-domain protein that regulates nuclear number. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Myre MA., O'Day DH. Biochem. Biophys. Res. Commun. (0006-291X) 2004 cbp4a_dicdi Calcium-binding protein 4a cbpD1 DDB_G0283153 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MVTKKEFLEDLTNATNEMIKAGDKNGDNQLSKKELYELFKKCKYPNPTLVTNSLLELFDLDKDGKLSVNEVKTALLVDYIIEAETCLKKFVDSIFKADSNKDNKITWDEARQFFVTSGSNEAQAKVFANSMFEDVDSDDDKCITREELREYAIEYYEIYPTE nucmr_dicdi Nucleomorphin numA Calmodulin-binding protein A cmbA numB Calmodulin-binding protein CaM-BP38 DDB_G0269114 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MDLDYSSDNSRLVADNQNNKTNTKNQSQLSTSSQIPQTSQSYQQQQQHNQQQQQQQQQKQNSRPSSPKTIQAKVNNNNNNNNNNNNNNNNNNNNGATISHPPTSQSNEDLSSSAEIHHDDSAQLNSNIFENLGFVIDITINLKRKMELVKIIKKNGGKSCYSCTKATHLITTKQGYLEKTQKVTQAISLGIPILVKEYVHYCAFKKELLGVENYLVSSLILNPTSTTLNSSQDLIEKPNEEEPQNGTINEQPIAMTIDNTLESNKPIETIQPSSLEKQEPKETELQTQQQPQTELKSELEPQQLQLIQEKDKNINNLSIDSNHMDTSKIEAGNNISNQTQSNIISSVVQTIEPLKECNKIDLDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSSSNNKNKNNVDEAQEGLNINSVMDVHLTSSTSSTLSSSDNQDNELLRDEGTTPKSKKKFSQKKNHLLNLKKSYQDPEIIAHSRPRKSSGGVSLVEALSDHANYISNLDGFKYYARANKSSLNSNATTSGGNNRSIKLNEYKYDDEEEDEEDEDEEDEEEDEEEEEEEEEEEEDYDDEDLNDEESDEDDFDSDEDVSRFIKGKLLQKQQKIYKDLERFEHSRQQQHHHHQSSQVNSSKPRSRSHSRDYIESEIAKYLLNNSEKQIPLSPTKKRSLSNQFHQDGGNNTTDGNLFNNFSTNGGGNRTNIDDSIKQSILESPSSSSLKSSKSKKSKKPFLPPLSTLVHILVTFIILSAFFMSLPSN numa-cbd1-1 Interaction between Nucleomorphin NumA and CBP4a detected by Y2H 178112 N/A 178114 unspecified role unspecified role prey prey gal4-ad tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 178115 unspecified role unspecified role bait bait deed domain binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gal4-dbd tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false numa-cbd1-2 Interaction between Nucleomorphin NumA and CBP4a detected by in vitro pull-down 178113 N/A 178115 unspecified role unspecified role bait bait deed domain binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 178114 unspecified role unspecified role prey prey gal4-ad tag tag western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Interaction is calcium-dependent