MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kristensen-2004-1 Phosphorylation of the regulatory beta-subunit of protein kinase CK2 by checkpoint kinase Chk1: identification of the in vitro CK2beta phosphorylation site. in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Kristensen LP., Larsen MR., Højrup P., Issinger OG., Guerra B. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation csk2b_human Casein kinase II subunit beta Phosvitin Protein G5a CSNK2B CK2N G5A protein protein human Homo sapiens Human MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR chk1_human Serine/threonine-protein kinase Chk1 CHEK1 CHK1 CHK1 checkpoint homolog Checkpoint kinase-1 Cell cycle checkpoint kinase protein protein human Homo sapiens Human MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT chek1-csnk2b 170381 csk2b_human 170382 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified Stoichiometry: 1.0 chk1_human 170383 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F1A homomint mint chek1-csnk2b-2 170381 csk2b_human 170382 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified Stoichiometry: 1.0 chk1_human 170383 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false As predicted, the C-terminal truncated CK2β (1–155) did not show a phosphorylation comparable to the one observed with CK2β wild-type (Fig. 3C, lanes 2 and 3). F3C homomint mint chek1-csnk2b-3 170381 chk1_human 170383 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 csk2b_human 170382 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F5A phosphorylation@213 mass detection of residue modification homomint mint