IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zollner-2004-2 Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a Bioelectrochemistry (1567-5394) 2004 zollner-2004-1 Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink predetermined predetermined participant predetermined Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a Bioelectrochemistry (1567-5394) 2004 zollner-2004-3 Analysis of the interaction of a hybrid system consisting of bovine adrenodoxin reductase and flavodoxin from the cyanobacterium Anabaena PCC 7119. in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Zollner A., Nogues I., Heinz A., Medina M., Gomez-Moreno C., Bernhardt R. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking experiment was performed with 1-ethyl-3-3-(3-dimethylamino propyl) carbodiimide (EDC). The proteins were then separated on SDS-PAGE. fig 1a Bioelectrochemistry (1567-5394) 2004 flav_nosso Flavodoxin isiB protein protein anaso Anabaena sp. (strain PCC 7119) MSKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL fenr_nosso Ferredoxin--NADP reductase petH protein protein anaso Anabaena sp. (strain PCC 7119) MSNQGAFDGAANVESGSRVFVYEVVGMRQNEETDQTNYPIRKSGSVFIRVPYNRMNQEMQRITRLGGKIVTIQTVSALQQLNGRTTIATVTDASSEIAKSEGNGKATPVKTDSGAKAFAKPPAEEQLKKKDNKGNTMTQAKAKHADVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY adro_bovin NADPH:adrenodoxin oxidoreductase, mitochondrial Ferredoxin--NADP(+) reductase FDXR ADXR protein protein bovin Bos taurus (Bovine) Bovine MAPRCWRWWPWSSWTRTRLPPSRSIQNFGQHFSTQEQTPQICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFYGNVEVGRDVTVQELQDAYHAVVLSYGAEDHQALDIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASASRAWGLRFFRSPQQVLPSPDGRRAAGIRLAVTRLEGIGEATRAVPTGDVEDLPCGLVLSSIGYKSRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSGWVKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRGVWPVSFSDWEKLDAEEVSRGQASGKPREKLLDPQEMLRLLGH adx_bovin Adrenodoxin, mitochondrial Adrenal ferredoxin Ferredoxin-1 Hepato-ferredoxin FDX1 ADX protein protein bovin Bos taurus (Bovine) Bovine MAARLLRVASAALGDTAGRWRLLARPRAGAGGLRGSRGPGLGGGAVATRTLSVSGRAQSSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE isib-peth-2 SPR: interaction between Flavodoxin (Fld) and Ferredoxin-NADP+-Reductase (FNR) from Anabaena 184918 N/A 184921 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 184922 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fld and FNR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. FNRred + Fldox : 1.8 s-1, Fldred + FNRox : 5300 s-1 isib-fdxr-2 SPR: interaction between Anabaena Flavodoxin (Fld) and bovin Adrenodoxin Reductase (AdR) 184918 N/A 184921 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 184923 unspecified role unspecified role prey prey mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fld and AdR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. AdRred + Fldox : 0.03 s-1, Fldred + AdRox : 0.6 s-1 fdx1-fdxr-1 SPR: interaction between bovin Adrenodoxin (Adx) and bovin Adrenodoxin Reductase (AdR) 184918 N/A 184924 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 184923 unspecified role unspecified role prey prey mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Adx and AdR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. AdRred + Adxox : 7.3 s-1, Adxred + AdRox : no reaction fdx1-peth-3 SPR: interaction between bovin Adrenodoxin (Adx) and ferredoxin-NADP+-reductase (FNR) from Anabaena 184918 N/A 184924 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 184922 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Adx and FNR in oxidized form are used. Reduction rate. red= reduced form, ox= oxidized form. FNRred + Adxox : 0.003 s-1, Adxred + FNRox : not detectable isib-peth-1 In vitro cross-linking: interaction between Flavodoxin (Fld) and ferredoxin-NADP+-reductase (FNR) from Anabaena 184919 N/A 184922 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 184921 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fld and FNR in oxidized form are used. stoichiometry 1:1 isib-fdxr-1 In vitro cross-linking : interaction between Anabaena Flavodoxin (Fld) and bovin adrenodoxin reductase (AdR) 184919 N/A 184923 unspecified role unspecified role neutral component neutral component mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 184921 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false Fld and AdR in oxidized form are used. Complex of stoichiometry 1:1 but also higher stoichiometries are observed isib-fdxr-3 hybrid system: Reduction of the Anabaena Flavodoxin (Fld ox) by the bovin Adrenodoxin Reductase (AdR red) 184920 N/A 184923 unspecified role unspecified role neutral component neutral component mature form binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 184921 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fld in oxidized form and AdR in reduced form are used. The rate-limiting step of this reaction seems to be the formation of a production complex in which electron transfer is possible as shown by the decrease of reaction when increasing Fld/Adr ratio.