IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ immink-2002-3 Analysis of MADS box protein-protein interactions in living plant cells. pethy-leaf Petunia leaf leaf fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 immink-2002-1 Analysis of MADS box protein-protein interactions in living plant cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 immink-2002-2 Analysis of MADS box protein-protein interactions in living plant cells. pethy-leaf Petunia leaf leaf fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Immink RG., Gadella TW., Ferrario S., Busscher M., Angenent GC. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 q40882_pethy fbp11 protein protein pethy Petunia hybrida (Petunia) MGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRVYEYANNNIKGTIERYKKATAETSNACTTQELNAQFYQQESKKLRQQIQLLQNTNRHLVGEGLSALNVRELKQLENRLERGITRIRSKKHEMILAETENLQKREIQLEQENTFLRSKIAENERLQELSMMPATGQEYNAFQQYFARNMLQLNMMEGGVPSYDPLPAHDKKSLQLE agl9_pethy Agamous-like MADS-box protein AGL9 homolog Floral homeotic protein FBP2 Floral-binding protein 2 FBP2 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPETNISTREALEISSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLQDLQRKEHALNEANRTLKQRLMEGSTLNLQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQNDPITVGGAGPSVNNYMAGWLP q9atf2_pethy FBP5 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKKIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFSSTSNMVKTLDRYQKCSYGTLEVNHRSVKDNNEERIYREYLKLKAKYESLQRYQRQLLGDELGPLNIDELEHLELQLDSSLKLIKSTRTQLMLDQLSDLQTKEKLWVEANKVLERKLEQIYAENNIQQSWGGGEQSGAYGQQHAQTQGFFQPLECNSTLQIGYDPATSSQITAVTSGQNVNGIIPGWML q9atf1_pethy FBP9 protein protein pethy Petunia hybrida (Petunia) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCSTSSMMKTLEKYQQCSYASLDPMQSANDTQNNYHEYLRLKARVELLQRSQRNLLGEDLGSLNSKELEQLEHQLDSSLKQIRSKKTQHMLDQLADLQQKEQMLAEANKQLRRKLEESAARIPLRLSWDNGGQPMQHNRLPPQTEGFFQPLGLNSSSPQFGYSPMGANEVNNAVSTAQNMNGFIPGWML fbp11-fbp2-2 FRET analysis reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 2 (FBP2) 178528 N/A 178531 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178532 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false fbp11-fbp5-2 FRET analysis reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 5 (FBP) 178528 N/A 178533 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178531 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false fbp11-fbp9-2 FRET analysis reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 9 (FBP9) 178528 N/A 178534 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178531 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false fbp9-fbp9 FRET analysis reveals homotypic association of the floral binding protein 9 (FBP9) 178528 N/A 178534 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178534 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false fbp5-fbp5 FRET analysis reveals homotypic association of the floral binding protein 5 (FBP) 178528 N/A 178533 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178533 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false fbp2-fbp2 FRET analysis reveals homotypic association of the floral binding protein 2 (FBP2) 178528 N/A 178532 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178532 unspecified role unspecified role neutral component neutral component c terminal cfp cyan florescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false fbp11-fbp2 Yeast-2-hybrid reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 2 (FBP2) 178529 N/A 178532 unspecified role unspecified role prey prey N/A 178531 unspecified role unspecified role bait bait physical association physical association false false false fbp11-fbp5 Yeast-2-hybrid reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 5 (FBP5) 178529 N/A 178533 unspecified role unspecified role prey prey N/A 178531 unspecified role unspecified role bait bait physical association physical association false false false fbp11-fbp9 Yeast-2-hybrid reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 9 (FBP9) 178529 N/A 178531 unspecified role unspecified role bait bait N/A 178534 unspecified role unspecified role prey prey physical association physical association false false false fbp11-fbp2-1 Colocalisation analysis reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 2 (FBP2) 178530 N/A 178532 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178531 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false fbp11-fbp5-1 Colocalisation analysis reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 5 (FBP) 178530 N/A 178533 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178531 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false fbp11-fbp9-1 Colocalisation analysis reveals interaction between the floral binding protein 11 (FBP11) and the floral binding protein 9 (FBP9) 178530 N/A 178531 unspecified role unspecified role neutral component neutral component c terminal cfp cyan fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 178534 unspecified role unspecified role neutral component neutral component c terminal yfp yellow fluorescent protein tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false