MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url&gt;http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nakano-2001a-1 Rethinking the role of phosducin: light-regulated binding of phosducin to 14-3-3 in rod inner segments. in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nakano K., Chen J., Tarr GE., Yoshida T., Flynn JM., Bitensky MW. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 partial coverage rapid curation nakano-2001a-2 Rethinking the role of phosducin: light-regulated binding of phosducin to 14-3-3 in rod inner segments. in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Nakano K., Chen J., Tarr GE., Yoshida T., Flynn JM., Bitensky MW. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 partial coverage rapid curation nakano-2001a-3 Rethinking the role of phosducin: light-regulated binding of phosducin to 14-3-3 in rod inner segments. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Nakano K., Chen J., Tarr GE., Yoshida T., Flynn JM., Bitensky MW. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 partial coverage rapid curation phos_rat Phosducin Pdc Rpr1 33 kDa phototransducing protein Rod photoreceptor 1 Protein MEKA protein protein rat Rattus norvegicus (Rat) Rat MEEAASQSLEEDFEGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRDDKDSKERMSRKMSIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPEREIHDLGQTNTEDEDIE mint May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism 1433e_rat 14-3-3 protein epsilon Ywhae Mitochondrial import stimulation factor L subunit protein protein rat Rattus norvegicus (Rat) Rat MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ o55157_rat CNG4.3 protein protein rat Rattus norvegicus (Rat) Rat MAKPGLNMELNRLVQDQPPGQEGPRPGPPNPAEHLPNVPSYRPATTRIPVLVSRRTALSNSNFTKEIRSSIRRLVPATKEHPELQVEDTDAEAGPLIPEETIPPPERPPVSPAKSDTLAVPSAATHRKKLPSQDDEAEELKALSPAESPVVAWSDPTTPQEADGEDRAASTASQNSAIINDRLQELVKMFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPDSAPAQKPAEAEAAEEEHYCDMLCCKFKRRPWKMYQFPQSIDPLTNLMYILWLFFVVLAWNWNCWLIPVRWAFPYQRADNIHLWLLMDYLCDFIYLLDITVFQMRLQFVKGGDIITDKKEMRNNYLKSQRFKMDLLCLLPLDFLYLKLGVNPLLRLPRCLKYMAFFEFNNRLEAILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYDGVGNSYIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRNNNKPKEEKSVLILPPRAGTPKLFNAALAAAGKMGPRGAKGGKLAHLRARLKELAALEAAARQQQLLEQAKSSQEAGGEEGSGATDQPAPQEPSEPKEPPEPPAPSSPPPASAKPEGSTEEAAGPPEPSVRIRVSPGPDPGEQTLSVEMLEEKKEEVE mint 1433e_bovin 14-3-3 protein epsilon YWHAE protein protein bovin Bos taurus (Bovine) Bovine MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner mint ywhae-pdc 218561 phos_rat 218564 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 1433e_rat 218565 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region feature prediction feature prediction undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F4A SHORTLABEL= rat retina<br>Interaction is stronger in dark adapted rat retina homomint domino mint pdc-ywhae 218561 phos_rat 218564 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 1433e_rat 218565 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region feature prediction feature prediction undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F4A SHORTLABEL= rat retina<br>Interaction is stronger in dark adapted rat retina homomint domino mint pdc-cngb1 218561 phos_rat 218564 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 o55157_rat 218566 polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false F4B SHORTLABEL= rat retina<br>Interaction is stronger in light adapted rat retina mint pdc-ywhae-1 218562 phos_rat 218564 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 1433e_rat 218565 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region feature prediction feature prediction undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 colocalization colocalization false false false F2 SHORTLABEL=rat retina (ROD inner segment) homomint domino mint pdc-ywhae-2 218563 phos_rat PHOS_RAT 218564 unspecified role unspecified role unspecified role unspecified role 1433e_bovin 1433E_BOVIN 218567 unspecified role unspecified role unspecified role unspecified role association association false false false homomint domino mint