IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lim-2000-1 Two rice MADS domain proteins interact with OsMADS1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lim J., Moon YH., An G., Jang SK. A cDNA from rice flowers with 2.0 - 2.5 cm pannicles was used in this study. sungkey@postech.ec.kr Plant Mol. Biol. (0167-4412) 2000 lim-2000-2 Two rice MADS domain proteins interact with OsMADS1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lim J., Moon YH., An G., Jang SK. A cDNA from rice flowers with 2.0 - 2.5 cm pannicles was used in this study. Figure 4 (b). sungkey@postech.ec.kr Plant Mol. Biol. (0167-4412) 2000 lim-2000-3 Two rice MADS domain proteins interact with OsMADS1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lim J., Moon YH., An G., Jang SK. A cDNA from rice flowers with 2.0 - 2.5 cm pannicles was used in this study. Figure 4 (c). sungkey@postech.ec.kr Plant Mol. Biol. (0167-4412) 2000 mads1_orysj MADS-box transcription factor 1 MADS1 LHS1 OsMADS1 Protein LEAFY HULL STERILE 1 Protein SEPALLATA-like OsJ_09913 LOC_Os03g11614 Os03g0215400 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSCMYKTLERYRSCNYNSQDAAAPENEINYQEYLKLKTRVEFLQTTQRNILGEDLGPLSMKELEQLENQIEVSLKQIRSRKNQALLDQLFDLKSKEQQLQDLNKDLRKKLQETSAENVLHMSWQDGGGHSGSSTVLADQPHHHQGLLHPHPDQGDHSLQIGYHHPHAHHHQAYMDHLSNEAADMVAHHPNEHIPSGWI mad14_orysj MADS-box transcription factor 14 MADS14 AGL10 FDRMADS6 OsMADS14 Protein AGAMOUS-like 10 Protein APETALA1-like B RAP1B RMADS211 OJ1112_G08.13 OSJNBa0032E21.04 OSJNBa0047E24.2 OsJ_12598 LOC_Os03g54160 Os03g0752800 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVQLKRIENKINRQVTFSKRRSGLLKKANEISVLCDAEVALIIFSTKGKLYEYATDSCMDKILERYERYSYAEKVLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKVLQKELVEKQKVQKQQVQWDQTQPQTSSSSSSFMMREALPTTNISNYPAAAGERIEDVAAGQPQHVRIGLPPWMLSHING mad15_orysj MADS-box transcription factor 15 MADS15 RAP1A FDRMADS3 OsMADS15 Protein APETALA1-like A RMADS215 OJ1567_G09.109-1 P0585H11.124-1 Os07g0108900 LOC_Os07g01820 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYATDSRMDKILERYERYSYAEKALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQKELVERQKNVRGQQQVGQWDQTQVQAQAQAQPQAQTSSSSSSMLRDQQALLPPQNICYPPVMMGERNDAAAAAAVAAQGQVQLRIGGLPPWMLSHLNA osmads1-osmads14-2 Yeast 2 hybrid analysis reveals interaction between the OSMADS1 protein and OSMADS14 protein 208058 N/A 208061 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 208062 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads1-osmads15 Yeast 2 hybrid analysis reveals interaction between the OSMADS1 protein and OSMADS15 protein 208058 N/A 208061 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 208063 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads1-osmads14-3 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS1 protein and OSMADS14 protein 208059 N/A 208061 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 208062 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads1-osmads15-1 Directed yeast 2 hybrid analysis reveals interaction between the OSMADS1 protein and OSMADS15 protein 208059 N/A 208061 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 208063 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false osmads1-osmads14-5 GST pulldown analysis reveals interaction between the OSMADS1 protein and OSMADS14 protein 208060 n/a 208062 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 208061 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false osmads1-osmads15-2 GST pulldown analysis reveals interaction between the OSMADS1 protein and OSMADS15 protein 208060 N/A 208063 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false s35 radiolabelled 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 208061 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false