IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gross-2000-1 TACI and BCMA are receptors for a TNF homologue implicated in B-cell autoimmune disease. in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Gross JA., Johnston J., Mudri S., Enselman R., Dillon SR., Madden K., Xu W., Parrish-Novak J., Foster D., Lofton-Day C., Moore M., Littau A., Grossman A., Haugen H., Foley K., Blumberg H., Harrison K., Kindsvogel W., Clegg CH. Specific binding experiments using radiolabelled (I 125) zTNF4 protein were carried out on baby hamster kidney cells which had been transfected and expressed TAC1 or BMCA protein expression constructs. grossj@zgi.com Nature (0028-0836) 2000 tn13b_human Tumor necrosis factor ligand superfamily member 13B TNF- and APOL-related leukocyte expressed ligand 1 B lymphocyte stimulator B-cell-activating factor Dendritic cell-derived TNF-like molecule UNQ401/PRO738 TNFSF13B BAFF BLYS TALL1 ZTNF4 TNFSF20 protein protein human Homo sapiens Human MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL tr13b_human Tumor necrosis factor receptor superfamily member 13B Transmembrane activator and CAML interactor TNFRSF13B TACI protein protein human Homo sapiens Human MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA tnr17_human Tumor necrosis factor receptor superfamily member 17 B-cell maturation protein TNFRSF17 BCM BCMA protein protein human Homo sapiens Human MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR tac1-ztnf4 The tumor necrosis factor receptor family member TAC1 protein interacts with the zTNF4 (BlyS) protein 174554 N/A 174555 unspecified role unspecified role prey prey i125 radiolabelled radiolabelled I (125) radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region FLAG tag was used to purify recombinant protein flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region extracellular domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 174556 unspecified role unspecified role bait bait mesau-bhk21 Mesocricetus auratus_BHK21 bhk-21 Cells from kidneys of five unsexed, one-day-old hamsters BHK-21/C13 cell physical association physical association false false false bcma-ztnf4-1 The tumor necrosis factor receptor family member BMCA protein interacts with the zTNF4 (BlyS) protein 174554 N/A 174557 unspecified role unspecified role bait bait mesau-bhk21 Mesocricetus auratus_BHK21 bhk-21 Cells from kidneys of five unsexed, one-day-old hamsters BHK-21/C13 cell N/A 174555 unspecified role unspecified role prey prey i125 radiolabelled radiolabelled I (125) radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region FLAG tag was used to purify recombinant protein flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region extracellular domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false