MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint itoh-1999-1 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Itoh M., Furuse M., Morita K., Kubota K., Saitou M., Tsukita S. J. Cell Biol. (0021-9525) 1999 itoh-1999-2 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Itoh M., Furuse M., Morita K., Kubota K., Saitou M., Tsukita S. J. Cell Biol. (0021-9525) 1999 itoh-1999-3 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins. mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed imaging technique imaging technique microscopy predetermined predetermined participant predetermined Itoh M., Furuse M., Morita K., Kubota K., Saitou M., Tsukita S. J. Cell Biol. (0021-9525) 1999 itoh-1999-4 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins. mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Itoh M., Furuse M., Morita K., Kubota K., Saitou M., Tsukita S. J. Cell Biol. (0021-9525) 1999 cld1_mouse Claudin-1 Cldn1 protein protein mouse Mus musculus Mouse MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFLISGLATLVATAWYGNRIVQEFYDPLTPINARYEFGQALFTGWAAASLCLLGGVLLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity zo1_mouse Tight junction protein ZO-1 Tjp1 Zo1 Zonula occludens protein 1 Zona occludens protein 1 Tight junction protein 1 protein protein mouse Mus musculus Mouse MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPDPEPVSDNEDDSYDEEVHDPRAGRGALANRRSEKSWARDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRRSQSRSPDQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAISTPVKHVDDHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGALPNSAHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQAIHRIDSPGLKPASQQKAEASSPVPYLSPETTPASSASAVNHNVSVTNVSLEEPAPAPPTSHASQPGCLGAPSAEAAHVVLRGEGPPLPPHADPAKVYRKEPYSEEMMRQNHILKQPALGHPGQRPDKEPNLAYEPQLPYIEKQASRDLEQPSYRYEVSSYTDQFSRNYDHRLRFEDRIPTYEDQWSYYDDKQPYQPRPFENQHPRDLDSRQHPEEASERGYFQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQPAPAYEVHNRYRPEAQPYSSTGPKSSEPKQYFDQYPRSYEQVPPPGFTSKTGHYEPLHGAAVVPPLIPSSQQKPEVLPSATKPQPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLENKKDVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDKTLYRLPEPQKPQVKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSKGKPETDAVDRSFSEKRYDPAQATPPPPPLPSQYSQPAPPLSSSSLHIHSKGAQGEGNSVSLDFQNSYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKAPVNGAEQTQKTITPVYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKTPTSPKTLMKAHSSTQPPEFDSGVETFSVHTDKPKYQMNNISTMPKAVPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF cld2_mouse Claudin-2 Cldn2 protein protein mouse Mus musculus Mouse MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity cld3_mouse Claudin-3 Cldn3 Cpetr2 Clostridium perfringens enterotoxin receptor 2 protein protein mouse Mus musculus Mouse MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVAGVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity cld5_mouse Claudin-5 Cldn5 Bec1 Lung-specific membrane protein Brain endothelial cell clone 1 protein protein protein mouse Mus musculus Mouse MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity cld4_mouse Claudin-4 Cldn4 Cper Cpetr1 Clostridium perfringens enterotoxin receptor protein protein mouse Mus musculus Mouse MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTGQMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMITAGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGLLCCSCPPRSNDKPYSAKYSAARSVPASNYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity cld6_mouse Claudin-6 Cldn6 Skullin protein protein mouse Mus musculus Mouse MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity cld7_mouse Claudin-7 Cldn7 protein protein mouse Mus musculus Mouse MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTGMMSCKMYDSVLALPGALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKAKKARIAMTGGIVFIVAGLAALVACSWIGHQIVTDFYNPLTPMNVKYEFGPAIFIGWAGSALVLLGGALLSCSCPGSESKAAYRAPRSYPKSNSSKEYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity cld8_mouse Claudin-8 Cldn8 protein protein mouse Mus musculus Mouse MATYALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANIRMQCKVYDSLLALSPDLQASRGLMCAASVLAFLAFMTAILGMKCTRCTGDDENVKSRILLTAGIIFFITGLVVLIPVSWVANSIIRDFYNPLVDVALKRELGEALYIGWTTALVLIAGGALFCCVFCCTERSNSYRYSVPSHRTTQRSFHAEKRSPSIYSKSQYV mint Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity zo2_mouse Tight junction protein ZO-2 Tjp2 Zo2 Zonula occludens protein 2 Zona occludens protein 2 Tight junction protein 2 protein protein mouse Mus musculus Mouse MEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQVAPLQGSPPLSHDDRGFEVIEEFDGRSFRSGYSERSRHSSHDMLSHSWEGNRERGRPHQRTQSRERERSRGRSLERGLDQEDYGRSRERSRGRSLERGLDRDFVSRDHSRGRSIDRDYDRDYERSYHEAYEPDYGGGYSPSYDRRAHPETRYERSRSREHLRSRSPSPESRSRHEHKGQHDPDRPIGVLLTKSKANEEYGLRLGSQIFIKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSKQTLINIPALNDSDSEVEDISEIESNRSFSPEERRQQYSDQDYHSSTEKLKERPSSREETSGRLSRMGATPTPFKSTGDITAAGVTEASREPRYQEEGPVPQPRTAPRVFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPKGETVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRENAGDRADFWRMRGQRSSGGVKKNLRKSREDLAAAVSVSTKFPAYEKVLLREAGFKRPVVLFGPIADIAMERLATELPDLFQTAKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTIRQRLSPTSNKSSRKLFDQANKLKKTCSHLFTATINVNSANDGWFGSLKDSIQQQQNEAVWVSEGKMEGMDDDAEDRMSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDNELEEPAEEPLVSSITRSSEPVQHEENIRKSSPEPRAQMRRAASRDQLRDASPPPAFKPEPPKARSQNREDSFDYSKSNLPATAGSEIPGGSTKGYPPPIAAKPAFGRPILKPSTPVPMPESEEVGESTEEQEDAPRSVLGRVKIFEKMDHKAKLQRMQELQEAQNARIEIAQKHPDIYAVPIKAPKPDAGLPPHMSSRPPEPQKAPSRLYQDTRGSYGSDPEEEEYRQQLAAHSKRGYYSQPSRYRDTEL zo3_mouse Tight junction protein ZO-3 Tjp3 Zo3 Zonula occludens protein 3 Zona occludens protein 3 Tight junction protein 3 protein protein mouse Mus musculus Mouse MEELTIWEQHTATLYKDPRRGFGIAVSGGHDRASGSVVVSDVVPGSPAEGRLRTGDHIVMVNGVSVENVTSAFAIQILKTCTKTANVTVKRPRRVQLPATKASPASGHQLSDQEEADHGRGYEGDSSSGSGRSWGERSRRSRAGRRGRVGSHGRRSSGGGSEANGLDLVSGYKRLPKQDVLMRPLKSVLVKRRNSEEFGVKLGSQIFIKHITESGLAARNHGLQEGDLILQINGVSSANLSLSDTRRLIEKSEGELTLLVLRDSGQFLVNIPPAVSDSDSSLMEDISDLTSELSQAPPSHVPPPPLKGQRSPEDSQTDSPVETPQPRRRERSVNSRAIAEPESPGESRYDIYRVPSRQSLEDRGYSPDTRVVSFPKGASIGLRLAGGNDVGIFVSGVQAGSPADGQGIQEGDEILQVNGMPFRNLTREEAVQFLLGLPPGEDMELVTQSKTGHSLRRWSQSRVGDSFYIRTHFELEPSPPYGLGFTRGDVFHVVDTLYPGSGPGHGHSSHGGLWLAARMGRDLREQERGVIPNQSRAEQLASLEAAQRAAGVGPGASVGSNPRAEFWRLRSLRRGTKKASTQRSREDLSALTRQGHYPPYERVVLREASFKRPVVILGPVADIAMKKLTTEMPEEFEIAESMSRTDSPSKIIKLDTVRVIAERDKHALLDVTPSAIERLNYVQYYPIVIFCAPESRPALKALREWLAPASRRSSRRLYAQAQKLQKHSGHLFTATIPLHGTSDSWYQEVKAVIQQQQARPIWTAEDQLNSSSEDLDLTGHGLAASSGDLSCDSRTNSDYEDTDGEGAYTDREGGPQDVDEEVAPTALARSSEPVWVDDHQGLMGHGTTITDKWETQADSHYTQDQRRQDSMRTYKHEALRKKFTRARDVESSDDEGYDWGPATDL mint cldn1-tjp1 194973 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F2 cytoplasmatic domain of claudin-1 to -8 homomint mint cldn1-tjp1-1 194973 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 13 nanomolar homomint mint cldn2-tjp1-1 194973 cld2_mouse 194979 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 homomint mint cldn3-tjp1 194973 cld3_mouse 194980 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 homomint mint cldn5-tjp1 194973 cld5_mouse 194981 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 homomint mint cldn4-tjp1 194973 cld4_mouse 194982 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 homomint mint cldn6-tjp1 194973 cld6_mouse 194983 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 homomint mint cldn7-tjp1 194973 cld7_mouse 194984 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 homomint mint cldn8-tjp1 194973 cld8_mouse 194985 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo1_mouse 194978 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F5 homomint mint cldn1-tjp2 194973 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo2_mouse 194986 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F3 homomint mint cldn1-tjp2-1 194973 cld1_mouse 194977 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo2_mouse 194986 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F4 11 nanomolar homomint mint cldn1-tjp3 194973 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo3_mouse 194987 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 physical association physical association false false false F4 18 nanomolar mint cldn1-tjp2-2 194974 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo2_mouse 194986 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pdz1 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 colocalization colocalization false false false F10 homomint mint cldn1-tjp1-2 194974 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo1_mouse 194978 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 colocalization colocalization false false false F10 homomint mint cldn1-tjp3-1 194974 zo3_mouse 194987 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 colocalization colocalization false false false F10 mint cldn1-tjp1-3 194975 cld1_mouse 194977 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 zo1_mouse 194978 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pdz1 Stoichiometry: 1.0 colocalization colocalization false false false F7 homomint mint cldn1-tjp2-3 194975 cld1_mouse 194977 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 zo2_mouse 194986 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 colocalization colocalization false false false proteins were c-myc tagged F8 homomint mint cldn1-tjp3-2 194976 zo3_mouse 194987 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pdz1 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cld1_mouse 194977 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false Stoichiometry: 1.0 physical association physical association false false false Zo-3 was tagged qith c-myc at its COOH termini F9 mint