IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ davies-1999-1 PLENA and FARINELLI: redundancy and regulatory interactions between two Antirrhinum MADS-box factors controlling flower development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Davies B., Motte P., Keck E., Saedler H., Sommer H., Schwarz-Sommer Z. schwarz@mpiz-koeln.mpg.de A cDNA library of Antirrhinum floral tissues at various stages of development (infloresences to mature flowers) was used in this study. EMBO J. (0261-4189) 1999 davies-1999-2 PLENA and FARINELLI: redundancy and regulatory interactions between two Antirrhinum MADS-box factors controlling flower development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Davies B., Motte P., Keck E., Saedler H., Sommer H., Schwarz-Sommer Z. Directed yeast two hybrid assay. Table (II). schwarz@mpiz-koeln.mpg.de A cDNA library of Antirrhinum floral tissues at various stages of development (infloresences to mature flowers) was used in this study. EMBO J. (0261-4189) 1999 q9xfm8_antma far FARINELLI protein protein antma Antirrhinum majus (Garden snapdragon) MASLSDQSTEVSPERKIGRGKIEIKRIENKTNQQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYANNSVKATIDRYKKASSDSSLNGSISEANTQYYQQEASKLRAQISNLQNQNRNMLGESLGALSLRELKNLESRVERGISRIRSKKNELLFAEIEYMQKRQEIDLHHNNQYLRAKIAESERVQGQHMNLMPGGSSGYEQLVETQPFDARNYLQVNGLQPNNDYPRQDQLPLQLV ag_arath Floral homeotic protein AGAMOUS F13C5.130 AG At4g18960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAYQSELGGDSSPLRKSGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSKKNELLFSEIDYMQKREVDLHNDNQILRAKIAENERNNPSISLMPGGSNYEQLMPPPQTQSQPFDSRNYFQVAALQPNNHHYSSAGRQDQTALQLV q38733_antma DEFH200 protein protein antma Antirrhinum majus (Garden snapdragon) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSTSMLNTLERYQKCNYGPPETNVSTREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQAMLDTLTDLQRKEHALNEANRSLKHRLMDGSQISLQWNPNAEDHVGYGRQPSQPSADGFYHPLECEPTLHIGFQSDQITVAGAGPSVNNYISGWLP q38742_antma squamosa protein protein antma Antirrhinum majus (Garden snapdragon) MGRGKVQLKRIENKINRQVTFSKRRGGLLKKAHELSVLCDAEVALIVFSNKGKLFEYSTDSCMDRILEKYERYSFAERQLVSNEPQSPANWTLEYSKLKARIELLQRNHRHYMGEDLDSMSLKEIQSLEQQLDTALKNIRTRKNQLLYDSISELQHKEKAIQEQNTMLAKKIKEKEKEIAQQPQWEHHRHHTNASIMPPPPQYSMAPQFPCINVGNTYEGEGANEDRRNELDLTLDSLYSCHLGCFAA q38734_antma DEFH49 protein protein antma Antirrhinum majus (Garden snapdragon) MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSNMLKTIERYQKSSYGSLEVNHQAKDIEASSYKEYLKLKSKYESLQGYQRHLLGDDLGPLNMNDLEHLEHQLETSLKHIRSTRTQVMLDQLSDLQTKEKMMVDANKALERKLEEIYAANHLQQSWGGGGDHSNAYNDHQHAQSQGFFQPLECNSTLQIGFNDPVASSQMTAPTDAQNMHGLVPGWML ag-far Yeast 2 hybrid analysis reveals interaction between AG protein and the FAR protein 207842 N/A 207844 unspecified role unspecified role prey prey N/A 207845 unspecified role unspecified role bait bait physical association physical association false false false A splice variant of FAR was detected in this study. The second form had four codons QQLF inserted between amino acids 103 and 104 of the protein. far-defh200-2 Yeast 2 hybrid analysis reveals interaction between FARINELLI (FAR) protein and the DEFH200 protein 207842 N/A 207846 unspecified role unspecified role prey prey N/A 207844 unspecified role unspecified role bait bait physical association physical association false false false far-squa-2 Yeast 2 hybrid analysis reveals interaction between FARNELLI (FAR) protein and the SQUA (SQUAMOSA) protein 207842 N/A 207847 unspecified role unspecified role prey prey N/A 207844 unspecified role unspecified role bait bait physical association physical association false false false far-defh49-1 Yeast 2 hybrid analysis reveals interaction between FARENILLI (FAR) protein and the DEFH49 protein 207842 N/A 207848 unspecified role unspecified role prey prey N/A 207844 unspecified role unspecified role bait bait physical association physical association false false false far-defh200-3 Directed yeast 2 hybrid analysis reveals interaction between FARINELLI (FAR) protein and the DEFH200 protein 207843 N/A 207844 unspecified role unspecified role bait bait N/A 207846 unspecified role unspecified role prey prey physical association physical association false false false far-defh49-2 Directed yeast 2 hybrid analysis reveals interaction between FARENILLI (FAR) protein and the DEFH49 protein 207843 N/A 207844 unspecified role unspecified role bait bait N/A 207848 unspecified role unspecified role prey prey physical association physical association false false false far-squa-3 Directed yeast 2 hybrid analysis reveals interaction between FARNELLI (FAR) protein and the SQUA (SQUAMOSA) protein 207843 N/A 207847 unspecified role unspecified role prey prey N/A 207844 unspecified role unspecified role bait bait physical association physical association false false false