IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gray-1999-1 Identification of an SCF ubiquitin-ligase complex required for auxin response in Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gray WM., del Pozo JC., Walker L., Hobbie L., Risseeuw E., Banks T., Crosby WL., Yang M., Ma H., Estelle M. Genes Dev. (0890-9369) 1999 gray-1999-2 Identification of an SCF ubiquitin-ligase complex required for auxin response in Arabidopsis thaliana. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gray WM., del Pozo JC., Walker L., Hobbie L., Risseeuw E., Banks T., Crosby WL., Yang M., Ma H., Estelle M. Transgenic plants expressing myc tagged TIR1 protein were used in this study Genes Dev. (0890-9369) 1999 gray-1999-3 Identification of an SCF ubiquitin-ligase complex required for auxin response in Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gray WM., del Pozo JC., Walker L., Hobbie L., Risseeuw E., Banks T., Crosby WL., Yang M., Ma H., Estelle M. Directed yeast 2 hybrid Genes Dev. (0890-9369) 1999 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE tir1-ask1 Yeast 2 hybrid analysis reveals interaction between TIR1 protein and ASK1 protein 182952 N/A 182955 unspecified role unspecified role prey prey N/A 182956 unspecified role unspecified role bait bait physical association physical association false false false tir1-ask2 Yeast 2 hybrid analysis reveals interaction between TIR1 protein and ASK2 protein 182952 N/A 182957 unspecified role unspecified role prey prey N/A 182956 unspecified role unspecified role bait bait physical association physical association false false false tir1-ask1-2 Anti-tag coimmunoprecipitation analysis reveals interaction between TIR1 protein and ASK1 protein 182953 N/A 182955 unspecified role unspecified role prey prey N/A 182956 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false tir1-ask2-2 Anti-tag coimmunoprecipitation analysis reveals interaction between TIR1 protein and ASK2 protein 182953 N/A 182957 unspecified role unspecified role prey prey N/A 182956 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false tir1-ask1-1 Yeast 2 hybrid analysis reveals interaction between TIR1 protein and ASK1 protein 182954 N/A 182955 unspecified role unspecified role prey prey N/A 182956 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q570C0:p.Pro10Ala Proline 10 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false tir1-ask2-1 Yeast 2 hybrid analysis reveals interaction between TIR1 protein and ASK2 protein 182954 N/A 182957 unspecified role unspecified role prey prey N/A 182956 unspecified role unspecified role bait bait Q570C0:p.Pro10Ala Proline 10 alanine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false