MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kwong-1995-1 Structure of beta 2-bungarotoxin: potassium channel binding by Kunitz modules and targeted phospholipase action. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kwong PD., McDonald NQ., Sigler PB., Hendrickson WA. Structure (0969-2126) 1995 vkth2_bunmu Kunitz-type serine protease inhibitor homolog beta-bungarotoxin B2 chain Beta-2-bungarotoxin protein protein bunmu Bungarus multicinctus Many-banded krait MSSGGLLLLLGLLTLCAELTPVSSRKRHPDCDKPPDTKICQTVVRAFYYKPSAKRCVQFRYGGCNGNGNHFKSDHLCRCECLEYR mint Beta-2 bungarotoxin is a presynaptic neurotoxin of the venom. The B chain is homologous to venom basic protease inhibitors but has no protease inhibitor activity and is non-toxic pa2b1_bunmu Basic phospholipase A2 beta-bungarotoxin A1 chain Phosphatidylcholine 2-acylhydrolase protein protein bunmu Bungarus multicinctus Many-banded krait MNPAHLLVLSAVCVSLLGAANIPPHPLNLINFMEMIRYTIPCEKTWGEYADYGCYCGAGGSGRPIDALDRCCYVHDNCYGDAEKKHKCNPKTQSYSYKLTKRTIICYGAAGTCGRIVCDCDRTAALCFGNSEYIEGHKNIDTARFCQ mint PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Inhibits neuromuscular transmission by blocking acetylcholine release from the nerve termini. Acts presynaptically ivbi2-pa2b1 101492 ivbi2_bunmu 101493 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 pa21b_bunmu 101494 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false In the xray complex 1bun, P00617 is chain A and P00989 is chain B Resolution 2.450 mint