IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ welting-2004-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Welting TJ., van Venrooij WJ., Pruijn GJ. Nucleic Acids Res. (0305-1048) 2004 pop1_human Ribonucleases P/MRP protein subunit POP1 POP1 KIAA0061 protein protein human Homo sapiens Human MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPEVNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTNRCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGIIISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLHCRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICKSVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQAYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQESAGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGLTREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKHSDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCSRTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARIAIEV rpp29_human Ribonuclease P protein subunit p29 POP4 RPP29 protein protein human Homo sapiens Human MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL rpp38_human Ribonuclease P protein subunit p38 RPP38 protein protein human Homo sapiens Human MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK rpp40_human Ribonuclease P protein subunit p40 RPP40 RNASEP1 RNase P subunit 1 protein protein human Homo sapiens Human MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLVMNTGPYYFVKNLPLHELITPEFISTFIKKGSCYALTYNTHIDEDNTVALLPNGKLILSLDKDTYEETGLQGHPSQFSGRKIMKFIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFISTYCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVSWEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP pop5_human Ribonuclease P/MRP protein subunit POP5 POP5 AD-008 HSPC004 x0003 protein protein human Homo sapiens Human MVRFKHRYLLCELVSDDPRCRLSLDDRVLSSLVRDTIARVHGTFGAAACSIGFAVRYLNAYTGIVLLRCRKEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGEEAAEAME rpp14_human Ribonuclease P protein subunit p14 RPP14 protein protein human Homo sapiens Human MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD rpp30_human Ribonuclease P protein subunit p30 RPP30 RNASEP2 RNase P subunit 2 protein protein human Homo sapiens Human MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG rpp25_human Ribonuclease P protein subunit p25 RPP25 protein protein human Homo sapiens Human MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGCGRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLSKDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA pop7_human Ribonuclease P protein subunit p20 POP7 RPP20 Ribonucleases P/MRP protein subunit POP7 homolog protein protein human Homo sapiens Human MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK rpp21_human Ribonuclease P protein subunit p21 RPP21 C6orf135 CAT60 Ribonucleoprotein V Ribonuclease P/MRP 21 kDa subunit protein protein human Homo sapiens Human MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ pop1-pop1-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131319 unspecified role unspecified role prey prey in vitro In vitro N/A 131319 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is a GST fusion protein pop1-pop4-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131320 unspecified role unspecified role prey prey in vitro In vitro N/A 131319 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is a GST fusion protein pop1-rpp38-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131321 unspecified role unspecified role prey prey in vitro In vitro N/A 131319 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is a GST fusion protein pop1-rpp40-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131322 unspecified role unspecified role prey prey in vitro In vitro N/A 131319 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is a GST fusion protein pop4-pop1-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131320 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131319 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein pop4-pop4-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131320 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131320 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein pop4-pop5-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131320 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 131323 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein pop4-rpp38-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131320 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131321 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein pop5-pop4-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131323 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131320 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein pop5-rpp14-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131323 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131324 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein rpp14-rpp30-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131325 unspecified role unspecified role prey prey in vitro In vitro N/A 131324 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is a GST fusion protein rpp14-rpp40-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131322 unspecified role unspecified role prey prey in vitro In vitro N/A 131324 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is a GST fusion protein pop7-q9bul9-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131326 unspecified role unspecified role prey prey in vitro In vitro N/A 131327 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is a GST fusion protein rpp21-rpp40-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131328 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131322 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein q9bul9-pop1-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131326 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131319 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein q9bul9-pop4-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131326 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131320 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein q9bul9-pop7-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131326 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131327 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST fusion protein rpp38-pop4-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131321 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131320 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is a GST protein fusion pop4-rpp14-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131324 unspecified role unspecified role prey prey in vitro In vitro N/A 131320 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false bait is GST tagged rpp14-rpp14-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131324 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131324 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is GST tagged pop4-q9bul9-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131320 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131326 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is GST tagged pop5-pop1-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131323 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131319 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is GST tagged pop5-q9bul9-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131323 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131326 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is GST tagged rpp14-pop5-1 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex 131318 N/A 131324 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 131326 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false bait is GST tagged