IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tee-2004-1 Characterizing the interaction of the mammalian eIF4E-related protein 4EHP with 4E-BP1. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Tee AR., Tee JA., Blenis J. FEBS Lett. (0014-5793) 2004 tee-2004-2 Characterizing the interaction of the mammalian eIF4E-related protein 4EHP with 4E-BP1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid protein sequence protein sequence identification protein sequence Tee AR., Tee JA., Blenis J. FEBS Lett. (0014-5793) 2004 if4e2_human Eukaryotic translation initiation factor 4E type 2 EIF4E2 mRNA cap-binding protein type 3 Eukaryotic translation initiation factor 4E-like 3 Eukaryotic translation initiation factor 4E homologous protein mRNA cap-binding protein 4EHP eIF4E-like protein 4E-LP EIF4EL3 protein protein human Homo sapiens Human MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP 4ebp1_human Eukaryotic translation initiation factor 4E-binding protein 1 Phosphorylated heat- and acid-stable protein regulated by insulin 1 EIF4EBP1 protein protein human Homo sapiens Human MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI 4ebp1_mouse Eukaryotic translation initiation factor 4E-binding protein 1 Eif4ebp1 Phosphorylated heat- and acid-stable protein regulated by insulin 1 protein protein mouse Mus musculus Mouse MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI if4e2_mouse Eukaryotic translation initiation factor 4E type 2 Eif4e2 Eukaryotic translation initiation factor 4E-like 3 eIF4E-like protein 4E-LP Eif4el3 protein protein mouse Mus musculus Mouse MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP eif4el3-eif4ebp1-1 Characterizing the interaction of the mammalian eIF4E-related protein 4EHP with 4E-BP1 142164 N/A 142166 unspecified role unspecified role bait bait N/A 142167 unspecified role unspecified role prey prey physical association physical association false false false bait is a flag-tagged protein prey is HA-tagged protein eif4ebp1-eif4el3-1 Characterizing the interaction of the mammalian eIF4E-related protein 4EHP with 4E-BP1 142165 N/A 142168 unspecified role unspecified role bait bait N/A 142169 unspecified role unspecified role prey prey physical association physical association false false false