IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ renault-2003-1 Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Renault L., Guibert B., Cherfils J. Nature (0028-0836) 2003 cyh2_human Cytohesin-2 PH, SEC7 and coiled-coil domain-containing protein 2 ARF nucleotide-binding site opener ARF exchange factor CYTH2 ARNO PSCD2L PSCD2 protein protein human Homo sapiens Human MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP arf1_human ADP-ribosylation factor 1 ARF1 protein protein human Homo sapiens Human MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK arf1-pscd2-3 Crystal structure of human Arf1 - human ARNO sec7 domain complexed with Brefeldin A 146665 N/A 146666 unspecified role unspecified role neutral component neutral component sec7 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q99418:p.[Phe190Tyr;Ala191Ser;Ser198Asp;Pro208Met] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 146667 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false The natural inhibitor Brefeldin A (BFA), GDP and Magnesium are bound to the complex ARNO is mutated : F190Y, A191S, S198D, P208M to confere BFA-sensitivity Human, bovin, mouse and rat ARF1 have the same sequence 1.86 working 17.9%, free 22.0% arf1-pscd2-4 Crystal structure of human Arf1 - human ARNO sec7 domain (mutated in E156K) complexed with Brefeldin A 146665 N/A 146666 unspecified role unspecified role neutral component neutral component sec7 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q99418:p.[Glu156Lys;Phe190Tyr;Ala191Ser;Ser198Asp;Pro208Met] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 146667 unspecified role unspecified role neutral component neutral component full length binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) 146678 146675 direct interaction direct interaction false false false the natural inhibitor Brefeldin A (BFA), GDP and Magnesium are bound to the complex ARNO is mutated : E156K (catalytic glutamic finger mutated) ARNO is mutated : F190Y, A191S, S198D, P208M to confere BFA-sensitivity. working 15.9%, free 17.0% 1.46