IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hassel-2003-1 CALEB/NGC interacts with the Golgi-associated protein PIST. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hassel B., Schreff M., Stube EM., Blaich U., Schumacher S. J. Biol. Chem. (0021-9258) 2003 hassel-2003-2 CALEB/NGC interacts with the Golgi-associated protein PIST. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hassel B., Schreff M., Stube EM., Blaich U., Schumacher S. J. Biol. Chem. (0021-9258) 2003 hassel-2003-3 CALEB/NGC interacts with the Golgi-associated protein PIST. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hassel B., Schreff M., Stube EM., Blaich U., Schumacher S. J. Biol. Chem. (0021-9258) 2003 hassel-2003-4 CALEB/NGC interacts with the Golgi-associated protein PIST. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Hassel B., Schreff M., Stube EM., Blaich U., Schumacher S. J. Biol. Chem. (0021-9258) 2003 gopc_mouse Golgi-associated PDZ and coiled-coil motif-containing protein Gopc PDZ protein interacting specifically with TC10 protein protein mouse Mus musculus Mouse MSAGGPCPAGAGGGPGGSSCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLRSELTETQAEKVVLEKEVHEQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSVEDLERELEANKTEKVKEARLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGSGNSGASCKDSSGEMKMLQGYNKKAVRDAHENGDVGAAGESPLDDTAARAAHLHSLHQKKAY cspg5_human Chondroitin sulfate proteoglycan 5 CSPG5 Neuroglycan C Acidic leucine-rich EGF-like domain-containing brain protein CALEB NGC protein protein human Homo sapiens Human MGRAGGGGPGRGPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVKGSPAWEPPANDTREEAGPPAAGEDEASWTAPGGELAGPEEVLQESAAVTGTAWLEADSPGLGGVTAEAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNLGGSTPDPQGPELTYPFQGTLEPQPASDIIDIDYFEGLDGEGRGADLGSFPGSPGTSENHPDTEGETPSWSLLDLYDDFTPFDESDFYPTTSFYDDLDEEEEEEEDDKDAVGGGDLEDENELLVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSENGTECRSGFVRHNGSCRSVCDLFPSYCHNGGQCYLVENIGAFCRCNTQDYIWHKGMRCESIITDFQVMCVAVGSAALVLLLLFMMTVFFAKKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT cspg5_chick Chondroitin sulfate proteoglycan 5 CSPG5 Acidic leucine-rich EGF-like domain-containing brain protein CALEB protein protein chick Gallus gallus (Chicken) Chicken MGVGGTSASDTALSLCPTAPEWPPRNGSSGRAWGGPLQSGAPINSTDPLGPQLEPPGGGPATADPTVGCMGCSGEGAASSVPPVPDAAQDPRLGVTGPTDGDGGVVALGSPEEVGSGEQPTRAGVGPTEGLTPRPPGLPSPGLGLSSPGPNLGLPSLDLPNPNLGLPDPNLGLPNPSLGLPSPGPTPDRPIPNPNPSLDLPDPGLAIQTPNLGLSNPNIPLPSPSPGPGTEPDLLPVAEDSEVSMELPQPSSSPAPAQRARGRTDRTWLGAPEPISAAPGTAEPPEIIDVDYYDVFDGGHGPGGGHGAGGAAQREPGGAATPWGLHELYDDFTPFDEADFYPTTSFYAEGDDDAEEELEEDEEEEEEEDGGLEDENGYRPPASAAPRVPPPPSPTEGTPMARPRPGERAVPENSSECRSGYVRHNSSCRSVCDLVPSYCHNGGQCYLVESHGAFCRCNTQDYTWHKGTRCEAIVTDFQVLCVAVGSAALVLLLLFMLTVFFAKKLYLLKTENSKLRKTKYRTPSELHNDNFSLSTIAEGSHPNDDPGAPHKLQDPLKPGLKDEEPLSILSTAPEEGSKGEPGGCGVPCLHNNLG ngc-gopc-1 Determination of NGC domain involved in the interaction with GOPC. 99417 N/A 99421 unspecified role unspecified role prey prey N/A 99422 unspecified role unspecified role bait bait physical association physical association false false false The intracellular domain of O95196 was used as bait. Full length of Q9ET11 found necessary for binding. ngc-gopc-2 GOPC associates with NGC in HEK-293 cells and can be co-precipitated. 99418 N/A 99421 unspecified role unspecified role bait bait N/A 99422 unspecified role unspecified role prey prey physical association physical association false false false Q9ET11 was VSV-tagged. O95196 was FLAG-tagged. Antibodies to VSV tag were used for detection. ngc-gopc-3 GOPC is preciptated by NGC-derived GOPC binding peptide. 99419 N/A 99421 unspecified role unspecified role prey prey N/A 99422 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Synthetic peptide comprising AA 441-460 of O95196 was used as bait in the pull down. VSV-tagged Q9ET11. ngc-gopc-4 CALEB co-localises with PIST in COS7 cells. 99420 N/A 99423 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 99421 unspecified role unspecified role neutral component neutral component vsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Visualised in COS7 cells using FLAG and VSV antibodies.