IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fribourg-2003-2 A novel mode of RBD-protein recognition in the Y14-Mago complex. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fribourg S., Gatfield D., Izaurralde E., Conti E. Nat. Struct. Biol. (1072-8368) 2003 fribourg-2003-1 A novel mode of RBD-protein recognition in the Y14-Mago complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fribourg S., Gatfield D., Izaurralde E., Conti E. Nat. Struct. Biol. (1072-8368) 2003 mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI rbm8a_human RNA-binding protein 8A HSPC114 MDS014 RNA-binding motif protein 8A Ribonucleoprotein RBM8A RNA-binding protein Y14 Binder of OVCA1-1 RBM8A RBM8 protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR rbm8a_drome RNA-binding protein 8A tsu Y14 CG8781 Protein tsunagi protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR mgn_drome Protein mago nashi mago mgn CG9401 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI mago-tsu-3 tsu engages mago in a close embrace 145859 N/A 145861 unspecified role unspecified role prey prey P61326:p.Leu136Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 145862 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false mago-tsu-4 tsu engages mago in a close embrace 145859 N/A 145862 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9Y5S9:p.Leu118Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 145861 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false mago-tsu-2 tsu engages mago in a close embrace 145860 N/A 145863 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 145864 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false 2.50 working 22.4%, free 27.2%