IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ leeksma-2002-1 Human sprouty 4, a new ras antagonist on 5q31, interacts with the dual specificity kinase TESK1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leeksma OC., Van Achterberg TA., Tsumura Y., Toshima J., Eldering E., Kroes WG., Mellink C., Spaargaren M., Mizuno K., Pannekoek H., de Vries CJ. o.c.leeksma@amc.uva.nl Eur. J. Biochem. (0014-2956) 2002 leeksma-2002-2 Human sprouty 4, a new ras antagonist on 5q31, interacts with the dual specificity kinase TESK1. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Leeksma OC., Van Achterberg TA., Tsumura Y., Toshima J., Eldering E., Kroes WG., Mellink C., Spaargaren M., Mizuno K., Pannekoek H., de Vries CJ. o.c.leeksma@amc.uva.nl Eur. J. Biochem. (0014-2956) 2002 tesk1_human Dual specificity testis-specific protein kinase 1 TESK1 Testicular protein kinase 1 protein protein human Homo sapiens Human MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS spy4_human Protein sprouty homolog 4 SPRY4 protein protein human Homo sapiens Human MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF tesk1-spry4 Interaction of Spry4 with testicular protein kinase 1 - Y2H 130600 N/A 130602 unspecified role unspecified role prey prey N/A 130603 unspecified role unspecified role bait bait physical association physical association false false false Partial clone suggests TESK residues 459-626 sufficient for interaction spry4-tesk1 Interaction of Spry4 with testicular protein kinase 1 - Y2H 130600 N/A 130603 unspecified role unspecified role bait bait N/A 130602 unspecified role unspecified role prey prey physical association physical association false false false tesk1-spry4-2 Interaction of TSEK1 and SPRY4 confirmed by coimmunoprecipitation 130601 N/A 130602 unspecified role unspecified role bait bait re myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 130603 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Interaction increases on EGF-stimulation tesk1-spry4-3 Interaction of TESK1 and SPRY4 confirmed by coimmunoprecipitation 130601 N/A 130603 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 130602 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Interaction increases on EGF-stimulation