MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ye-2001-1 The structure of a Michaelis serpin-protease complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye S., Cech AL., Belmares R., Bergstrom RC., Tong Y., Corey DR., Kanost MR., Goldsmith EJ. PDBe - Data obtained from the Protein Data Bank Europe Nat. Struct. Biol. (1072-8368) 2001 try2_rat Anionic trypsin-2 Prss2 Try2 Anionic trypsin II Pretrypsinogen II Serine protease 2 protein protein rat Rattus norvegicus (Rat) Rat MRALLFLALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN sera_manse Alaserpin Serpin-1 protein protein manse Manduca sexta (Tobacco hawkmoth) Tobacco hornworm Tobacco hawkmoth MKIIMCIFGLAALAMAGETDLQKILRESNDQFTAQMFSEVVKANPGQNVVLSAFSVLPPLGQLALASVGESHDELLRALALPNDNVTKDVFADLNRGVRAVKGVDLKMASKIYVAKGLELNDDFAAVSRDVFGSEVQNVDFVKSVEAAGAINKWVEDQTNNRIKNLVDPDALDETTRSVLVNAIYFKGSWKDKFVKERTMDRDFHVSKDKTIKVPTMIGKKDVRYADVPELDAKMIEMSYEGDQASMIIILPNQVDGITALEQKLKDPKALSRAEERLYNTEVEIYLPKFKIETTTDLKEVLSNMNIKKLFTPGAARLENLLKTKESLYVDAAIQKAFIEVNEEGAEAAAANAFGIVPASLILYPEVHIDRPFYFELKIDGIPMFNGKVIEP prss2-sera-1 Crystal structure of michaelis serpin-trypsin complex 99779 N/A 99780 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 1.0 N/A 99781 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 84.200%, free 76.900% 2.3A