MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint horvath-2001-1 DNA G-quartets in a 1.86 A resolution structure of an Oxytricha nova telomeric protein-DNA complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Horvath MP., Schultz SC. Horvath@biology.utah.edu J. Mol. Biol. (0022-2836) 2001 teba_steno Telomere-binding protein subunit alpha MAC-56A MAC-56K MAC-56S Telomere-binding protein 56 kDa subunit TEBP alpha protein protein oxyno Oxytricha nova MSTAAKQNRSTSRVSKKKTAAPKEGAAKKSDKGHKYEYVELAKASLTSAQPQHFYAVVIDATFPYKTNQERYICSLKIVDPTLYLKQQKGAGDASDYATLVLYAKRFEDLPIIHRAGDIIRVHRATLRLYNGQRQFNANVFYSSSWALFSTDKRSVTQEINNQDAVSDTTPFSFSSKHATIEKNEISILQNLRKWANQYFSSYSVISSDMYTALNKAQAQKGDFDVVAKILQVHELDEYTNELKLKDASGQVFYTLSLKLKFPHVRTGEVVRIRSATYDETSTQKKVLILSHYSNIITFIQSSKLAKELRAKIQDDHSVEVASLKKNVSLNAVVLTEVDKKHAALPSTSLQDLFHHADSDKELQAQDTFRTQFYVTKIEPSDVKEWVKGYDRKTKKSSSLKGASGKGDNIFQVQFLVKDASTQLNNNTYRVLLYTQDGLGANFFNVKADNLHKNADARKKLEDSAELLTKFNSYVDAVVERRNGFYLIKDTKLIY mint May function as protective capping of the single-stranded telomeric overhang. May also participate in telomere length regulation during DNA replication. Bind specifically to the T4G4-containing extension on the 3'strand and protect this region of the telomere from nuclease digestion and chemical modification tebb_steno Telomere-binding protein subunit beta MAC-41A MAC-41S Telomere-binding protein 41 kDa subunit TEBP beta protein protein oxyno Oxytricha nova MSKGASAPQQQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYFFVAPYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQAAINKTVKGDNLVDISKVADAAGKKGKVDAGIVKASASKGDEFSDFSFKEGNTATLKIADIFVQEKGKDALNKAADHTDGAKVKGGAKGKGKAAAKAAKGKKLSAKKGDSSAADVRKSVDKIVKYTPSKGSRKDTPQKSQAPAAGKSSAKKGGKKAVPSAPSPSGKKSALTTDKMTMAQFVKYLDWHEKKKGGKVSSGGKVLGKRSAGKASATSGKASKASKKTAAKK May function as protective capping of the single-stranded telomeric overhang. May also participate in telomere length regulation during DNA replication. Bind specifically to the T4G4-containing extension on the 3'strand and protect this region of the telomere from nuclease digestion and chemical modification mint mac_41a-mac_56a 100550 teba_oxyno 100551 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 tebb_oxyno 100552 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false In the xray complex 1jb7, P29549 is chain A and P16458 is chain B Resolution 1.860 mint