MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tanoue-2000-1 A conserved docking motif in MAP kinases common to substrates, activators and regulators. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tanoue T., Adachi M., Moriguchi T., Nishida E. Nat. Cell Biol. (1465-7392) 2000 mp2k1_xenla Dual specificity mitogen-activated protein kinase kinase 1 map2k1 ERK activator kinase 1 MAPK/ERK kinase 1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPKKKPTPIQLNPNPEGTAVNGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVERDPASSELAPRPRPPGRPISSYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVHSFIKQSELEEVDFAGWLCSTMGLKQPSTPTHAAGV Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases mint mk01_xenla Mitogen-activated protein kinase 1 mapk1 mpk1 Myelin xP42 protein kinase Myelin basic protein kinase M phase MAP kinase protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAAAGAASNPGGGPEMVRGQAFDVGPRYINLAYIGEGAYGMVCSAHDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPGY mint Phosphorylates microtubule-associated protein 2 (MAP2). Myelin basic protein (MBP), and Elk-1; may promote entry in the cell cycle. Activated by M phase promoting factor (MPF) map2k1-mapk1 97807 mp2k1_xenla 97808 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 mk01_xenla 97809 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F2A F2B mint