IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ witte-2000-3 Inhibition of the c-Jun N-terminal kinase/AP-1 and NF-kappaB pathways by PICOT, a novel protein kinase C-interacting protein with a thioredoxin homology domain. in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Witte S., Villalba M., Bi K., Liu Y., Isakov N., Altman A. Jurkat T cell cDNA library J. Biol. Chem. (0021-9258) 2000 witte-2000-1 Inhibition of the c-Jun N-terminal kinase/AP-1 and NF-kappaB pathways by PICOT, a novel protein kinase C-interacting protein with a thioredoxin homology domain. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Witte S., Villalba M., Bi K., Liu Y., Isakov N., Altman A. Jurkat T cell cDNA library J. Biol. Chem. (0021-9258) 2000 witte-2000-2 Inhibition of the c-Jun N-terminal kinase/AP-1 and NF-kappaB pathways by PICOT, a novel protein kinase C-interacting protein with a thioredoxin homology domain. human-jurkat Homo sapiens jurkat Human T cell leukemia coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip monoclonal western monoclonal antibody western blot monoclonal western Witte S., Villalba M., Bi K., Liu Y., Isakov N., Altman A. Jurkat T cell cDNA library J. Biol. Chem. (0021-9258) 2000 witte-2000-4 Inhibition of the c-Jun N-terminal kinase/AP-1 and NF-kappaB pathways by PICOT, a novel protein kinase C-interacting protein with a thioredoxin homology domain. human-jurkat Homo sapiens jurkat Human T cell leukemia imaging technique imaging technique microscopy immunostaining immunostaining Witte S., Villalba M., Bi K., Liu Y., Isakov N., Altman A. Jurkat T cell cDNA library J. Biol. Chem. (0021-9258) 2000 glrx3_human Glutaredoxin-3 GLRX3 Thioredoxin-like protein 2 PKC-interacting cousin of thioredoxin PKC-theta-interacting protein PICOT HUSSY-22 TXNL2 protein protein human Homo sapiens Human MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN kpct_human Protein kinase C theta type PRKCQ nPKC-theta PRKCT protein protein human Homo sapiens Human MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS prkcq-txnl2-3 Interaction between PKCtheat and TXNL2 confirmed by GST pull-down 134514 N/A 134518 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 134519 unspecified role unspecified role prey prey physical association physical association false false false prkcq-txnl2-5 Interaction between PKCtheat and TXNL2 confirmed by GST pull-down 134514 N/A 134519 unspecified role unspecified role prey prey N/A 134518 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false prkcq-txnl2-1 Interaction of PKCtheta and TXNL2 identified by Y2H 134515 N/A 134519 unspecified role unspecified role bait bait N/A 134518 unspecified role unspecified role prey prey physical association physical association false false false The observed interaction in yeast requires full-length PKCtheta but does not intact catalytic activity. prkcq-txnl2-2 Interaction between PKCtheta and TXNL2 confirmed by coimmunoprecipitation 134516 N/A 134518 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 134519 unspecified role unspecified role prey prey physical association physical association false false false prkcq-txnl2-4 Interaction between PKCtheta and TXNL2 confirmed by colocalisation 134517 N/A 134519 unspecified role unspecified role neutral component neutral component N/A 134518 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false