IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ altmann-1997-1 A novel inhibitor of cap-dependent translation initiation in yeast: p20 competes with eIF4G for binding to eIF4E. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Altmann M., Schmitz N., Berset C., Trachsel H. EMBO J. (0261-4189) 1997 if4e_yeast Eukaryotic translation initiation factor 4E CDC33 mRNA cap-binding protein eIF-4F 25 kDa subunit TIF45 YOL139C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL 5B9162E1BD0B1BDE caf20_yeast Cap-associated protein CAF20 CAF20 CAP20 YOR276W O5453W CAF2 20 kDa cap-associated protein CCR4-associated factor 2 p20 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKYTIDELFQLKPSLTLEVNFDAVEFRAIIEKVKQLQHLKEEEFNSHHVGHFGRRRSSHHHGRPKIKHNKPKVTTDSDGWCTFEAKKKGSGEDDEEETETTPTSTVPVATIAQETLKVKPNNKNISSNRPADTRDIVADKPILGFNAFAALESEDEDDEA 870CA17343798805 if43yeast-if4eyeast A novel inhibitor of cap-dependent translation initiation in yeast: p20 competes with eIF4G for binding to eIF4E 14245 N/A 14246 unspecified role unspecified role prey prey N/A 14247 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false if4yeast-if43eyeast A novel inhibitor of cap-dependent translation initiation in yeast: p20 competes with eIF4G for binding to eIF4E 14245 N/A 14246 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 14247 unspecified role unspecified role prey prey physical association physical association false false false