IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ clemens-1996-1 A Drosophila protein-tyrosine phosphatase associates with an adapter protein required for axonal guidance. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Clemens JC., Ursuliak Z., Clemens KK., Price JV., Dixon JE. J. Biol. Chem. (0021-9258) 1996 clemens-1996-2 A Drosophila protein-tyrosine phosphatase associates with an adapter protein required for axonal guidance. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Clemens JC., Ursuliak Z., Clemens KK., Price JV., Dixon JE. J. Biol. Chem. (0021-9258) 1996 clemens-1996-3 A Drosophila protein-tyrosine phosphatase associates with an adapter protein required for axonal guidance. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip polyclonal western polyclonal antibody western blot polyclonal western Clemens JC., Ursuliak Z., Clemens KK., Price JV., Dixon JE. J. Biol. Chem. (0021-9258) 1996 q9w0g1-2 Tyrosine-protein phosphatase non-receptor type 61F Ptp61F dPTP61F CG9181 DPTP61Fn Nuclear protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSEQKTSGSGSAAAARLQIEAEYKDKGPQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGSVDYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKLHDPTFLDAEEPLISNDTETHTLDELPPPLPPRVQSLNLPLAPNSGGILSLNMRAAQANGAESIGKELSKDALNNFINQHDMIHDAEVADSRPLPPLPVRAFNDSDSDEDYLLDDDDEDDTDEDEEYETINEHDADPVNGHVPATTQPHADDVNANNEKPAVPVDEQHKANGIDPIPGQLPASPENELKRRKRNEYQASLEQKVNDMKRKQRENEDKQLAAKKRRRGNRLKKSKTK q24218_drome dock CG3727 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAGNMKHGKSQDDVCYVVAKYDYAAQGAQELDLRKNERYLLLDDSKHWWRVQNSRNQSGYVPSNYVKKEKPSLFDSIKKKVKKGSGSKTLPNCSPSRQVESPTMSRRLPPDPAEAIGTAVVKYNYQAQQPDELSLTKGTRILILEKSNDGWWRGQSGNSVGWFPSNYTTEDCDNDGEIHTYAMAENVLDIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNTSASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDTVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVEQNMYCIGQRKFHSLDQLVDHYQRAPIYTNKQGEKLYLVRSLPKANGT ptp61_drome Tyrosine-protein phosphatase non-receptor type 61F Ptp61F CG9181 dPTP61F protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSEQKTSGSGSAAAARLQIEAEYKDKGPQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGSVDYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKLHDPTFLDAEEPLISNDTETHTLDELPPPLPPRVQSLNLPLAPNSGGILSLNMRAAQANGAESIGKELSKDALNNFINQHDMIHDAEVADSRPLPPLPVRAFNDSDSDEDYLLDDDDEDDTDEDEEYETINEHDADPVNGHVPATTQPHADDVNANNEKPAVPVDEQHKANGIDPIPGQLPASPENELKRRKRNEYQASLEQKVNDMKRKQRENEDKQLAAKKRRSLLTYIAAGVVVGVICAYAYTKLG ptp61f-dock-1 interaction between PTP61F and Dock identified by Y2H. 14281 N/A 14284 unspecified role unspecified role bait bait N/A 14285 unspecified role unspecified role prey prey physical association physical association false false false dock-ptp61f-1 Interaction identified by Y2H 14281 N/A 14286 unspecified role unspecified role prey prey N/A 14285 unspecified role unspecified role bait bait physical association physical association false false false dock-ptp61f-2 Interaction detected by GST pulldown assay. 14282 N/A 14285 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 14286 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false DOCK is GST tagged. dock-ptp61f-4 ptp61f C-terminus interacts with DOCK, detected by GST pull down assay. 14282 N/A 14285 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 14286 unspecified role unspecified role prey prey c-terminus binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false DOCK is expressed as a GST fusion protein. C terminal half of PTP61F (AA 298-535) used in the expt. ptp61f-dock-2 Interaction detected by coimmunoprecipitation. 14283 N/A 14286 unspecified role unspecified role bait bait N/A 14285 unspecified role unspecified role prey prey physical association physical association false false false dock-ptp61f-3 Interaction detected by coimmunoprecipitation. 14283 N/A 14285 unspecified role unspecified role bait bait N/A 14286 unspecified role unspecified role prey prey physical association physical association false false false