UniProt UniProt http://www.uniprot.org kondo-1993-1 Sharing of the interleukin-2 (IL-2) receptor gamma chain between receptors for IL-2 and IL-4. in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink predetermined predetermined participant predetermined Kondo M., Takeshita T., Ishii N., Nakamura M., Watanabe S., Arai K., Sugamura K. Proteins were crosslinked before cell lysis. Science (0036-8075) 1993 kondo-1993-2 Sharing of the interleukin-2 (IL-2) receptor gamma chain between receptors for IL-2 and IL-4. in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink predetermined predetermined participant predetermined Kondo M., Takeshita T., Ishii N., Nakamura M., Watanabe S., Arai K., Sugamura K. Proteins were crosslinked before cell lysis. Science (0036-8075) 1993 il2_mouse Interleukin-2 Il2 Il-2 T-cell growth factor protein protein mouse Mus musculus Mouse MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ il2rg_mouse Cytokine receptor common subunit gamma Il2rg p64 gammaC Interleukin-2 receptor subunit gamma protein protein mouse Mus musculus Mouse MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA il4_mouse Interleukin-4 Il4 Il-4 B-cell stimulatory factor 1 Lymphocyte stimulatory factor 1 IGG1 induction factor B-cell growth factor 1 B-cell IgG differentiation factor protein protein mouse Mus musculus Mouse MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS il2rg-il2-1 16669 N/A 16671 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts N/A 16672 unspecified role unspecified role bait bait mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts direct interaction direct interaction false false false Il2 was affinity labelled. Proteins were crosslinked before cell lysis. il2rg-il4-1 16670 N/A 16672 unspecified role unspecified role bait bait mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts N/A 16673 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts direct interaction direct interaction false false false Il4 was affinity labelled. Proteins were cross-linked before cell lysis.