MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint behrens-2003-1 Identification of members of the Bex gene family as olfactory marker protein (OMP) binding partners. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Behrens M., Margolis JW., Margolis FL. J. Neurochem. (0022-3042) 2003 behrens-2003-3 Identification of members of the Bex gene family as olfactory marker protein (OMP) binding partners. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Behrens M., Margolis JW., Margolis FL. J. Neurochem. (0022-3042) 2003 behrens-2003-2 Identification of members of the Bex gene family as olfactory marker protein (OMP) binding partners. in vitro In vitro phage display phage display predetermined predetermined participant predetermined Behrens M., Margolis JW., Margolis FL. J. Neurochem. (0022-3042) 2003 omp_mouse Olfactory marker protein Omp protein protein mouse Mus musculus Mouse MAEDGPQKQQLEMPLVLDQDLTQQMRLRVESLKQRGEKKQDGEKLIRPAESVYRLDFIQQQKLQFDHWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPAAIFWRKEDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVVFNQL mint May act as a modulator of the olfactory signal-transduction cascade bex1_mouse Protein BEX1 Bex1 Rex3 Brain-expressed X-linked protein 1 homolog Reduced expression protein 3 protein protein mouse Mus musculus Mouse MESKDQGVKNLNMENDHQKKEEKEEKPQDTIRREPAVALTSEAGKNCAPRGGRRRFRVRQPIAHYRWDLMQRVGEPQGRMREENVQRFGGDVRQLMEKLRERQLSHSLRAVSTDPPHHDHHDEFCLMP mint Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states bex2_mouse Protein BEX2 Bex2 Brain-expressed X-linked protein 2 homolog protein protein mouse Mus musculus Mouse MESKVEQGVKNLNMENDHQEKEEKEEKPQDASKRDPIVALPFEAGDYYVPRGGRRRFRVRQPIVHYRWDLMHRVGEPQGRMREENVQRFGDDVRQLMEKLRERQLSHSLRAVSTDPPHHDHHDEFCLMP mint bex1-omp 12817 omp_mouse OMP 12820 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 bex1_mouse Q9R224 12821 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint bex2-omp 12817 omp_mouse OMP 12820 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 bex2_mouse Q9WTZ8 12822 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint bex1-omp-1 12818 omp_mouse OMP 12820 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 bex1_mouse Bex1 12821 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 colocalization colocalization false false false F6 mint bex1-omp-2 12818 omp_mouse OMP 12820 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell bex1_mouse Bex1 12821 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F6 mint omp-bex2 12819 bex2_mouse Q9WTZ8 12822 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 omp_mouse OMP 12820 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint