MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint matsuzaw-2003-1 Structural analysis of Siah1 and its interactions with Siah-interacting protein (SIP). in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Matsuzawa S., Li C., Ni CZ., Takayama S., Reed JC., Ely KR. J. Biol. Chem. (0021-9258) 2003 matsuzawa-2003-1 Structural analysis of Siah1 and its interactions with Siah-interacting protein (SIP). in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Matsuzawa S., Li C., Ni CZ., Takayama S., Reed JC., Ely KR. J. Biol. Chem. (0021-9258) 2003 siah1_human E3 ubiquitin-protein ligase SIAH1 Seven in absentia homolog 1 Siah-1a SIAH1 HUMSIAH RING-type E3 ubiquitin transferase SIAH1 protein protein human Homo sapiens Human MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC nhrf2_human Na(+)/H(+) exchange regulatory cofactor NHE-RF2 SLC9A3R2 NHERF2 Tyrosine kinase activator protein 1 SRY-interacting protein 1 Solute carrier family 9 isoform A3 regulatory factor 2 NHE3 kinase A regulatory protein E3KARP Sodium-hydrogen exchanger regulatory factor 2 protein protein human Homo sapiens Human MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF siah1-slc9a3r2 13124 siah1_human SIAH1 13126 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 nhrf2_human NHRF2 13127 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint siah1-slc9a3r2-1 13125 siah1_human SIAH1 13126 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 nhrf2_human NHRF2 13127 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint