IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2002-2 Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Li S., Xu C., Carthew RW. Mol. Cell. Biol. (0270-7306) 2002 li-2002-1 Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li S., Xu C., Carthew RW. Mol. Cell. Biol. (0270-7306) 2002 li-2002-3 Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Li S., Xu C., Carthew RW. Equal volumes of 15, 20, 25, and 30% glycerol were overlaid in ultracentrifuge tubes and left overnight to form the density gradient. Mol. Cell. Biol. (0270-7306) 2002 sina_drome E3 ubiquitin-protein ligase sina sina CG9949 Seven in absentia protein RING-type E3 ubiquitin transferase sina protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV phyl_drome Protein phyllopod phyl CG10108 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTNQQQQANPSAAVAAPAASSEYLKRTCLICGCHTNQTINIYEPRSGPNIVQLIQAKFKFQPLNEDKFLCFSCNNWLINWHSLQAVNSNEAESQSQSPSHMGNSVLQQERTKLRPVAMVRPTVRVQPQSQPQLQPQVPINPTPAPIVYSKRRASRRSASVSRMSRVLRQCCVESLRRSPKKRNQQSVFVCLRPQGQKRSNAICKVECVAPRRKPVERLVKDVAATATPTPVLNTQSTPTYQRFPQPSVDGKVVAMFRRLGTTLSREEPAAYSAESNPACSKLPQIMSPLKEAPRWTRDLDDDEILLEFDTAISEVLPTARYQVTHEENKENQQAQEMELELEEEEEVDGRAELEVVQEAEAPLEPQSHHKQGNSHQNSHQASIQLAGLRLPMGLSISLV ttka_drome Protein tramtrack, alpha isoform ttk FTZ-F2 CG1856 Tramtrack p88 Repressor protein fushi tarazu protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTEVNDDKPSPAAAAAGAGATGSESTATTPQLQRIQPYLVPQRNRSQAGGLLASAANAGNTPTLPVQPSLLSSALMPKRKRGRPRKLSGSSNGTGNDYDDFDRENMMNDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHTDDLNESRDSLPSKRSKNSKDHRVVSHHEDNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSETISLLEISDERESAPVHLPTILGLKIRAINTTTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQLRGGAKDPEVPPATRITGAVTPNAALNAEEQSKEMPKKNQDEVNACIGLHSLANAAEQQAAQVASTGNLHHQLLLHMAANNSMLNTTDYYQQQQQESPSSAGQFMDDDLELLSLNDQQDKSDEPDHEMVTLADENAGLPGYQGNEAEATPAQEDSPAAETATAPPPAPRSGKKGAKRPIQRRRVRRKAQSTLDDQAEHLTEMSVRGLDLFRYASVVEGVYRCTECAKENMQKTFKNKYSFQRHAFLYHEGKHRKVFPCPVCSKEFSRPDKMKNHLKMTHENFTPPKDIGAFSPLKYLISAAAAGDMHATIYQQQQDHYHRQLAEQLEQQNASFDSRDSSLILPDVKMEHAEDQDAEQEAELSDGGYDASNPAAAAAAMLSLQQDVIIKDEIQISPSPSPTPPASCAVAEGKSLALASTAQTAT phyl-sina-1 Interaction detected by immunoprecipitation assay. 15258 N/A 15261 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15262 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Phyl is HA tagged. ttk-sina-1 Interaction detected by immunoprecipitation assay. 15258 N/A 15263 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15261 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Ttk is HA tagged. Interaction of Ttk with Sina is weaker than its interaction with Phyl. sina-sina-1 Interaction detected by immunoprecipitation. 15258 N/A 15261 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15261 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Sina is HA tagged and the immunoprecipitation of untagged Sina observed. ttk-phyl-1 Interaction detected by immunoprecipitation assay. 15258 N/A 15262 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15263 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Ttk is HA tagged. ttk-sina-2 ttk-sina-phyl Interaction detected by immunoprecipitation. 15258 N/A 15262 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15263 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15261 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Ttk is HA tagged. phyl-ttk-1 Phyl domain interacting with Ttk determined by deletion mutant analysis. 15258 N/A 15262 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15263 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fragment AA241-320 of Phyl was sufficient to interact with Ttk. Ttk was HA tagged. sina-phyl-2 Sina domain interacting with Phyl determined by deletion mutant analysis. 15258 N/A 15262 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15261 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fragment AA 167-314 of Sina was sufficient to interact with Phyl. Phyl was HA tagged. ttk-phyl-2 Ttk domain interacting with Phyl determined by deletion mutant analysis. 15258 N/A 15263 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15262 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false N-terminal 122 AA of Ttk were sufficient to interact with HA tagged Phyl. sina-ttk-1 Interaction detected by GST pull down assay. 15259 N/A 15263 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15261 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Sina is GST tagged. sina-phyl-1 Interaction determined by GST pull down assay. 15259 N/A 15261 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15262 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Phyl is GST tagged. phyl-sina-2 Phyl domain interacting with Sina determined by deletion mutant analysis. 15259 N/A 15262 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 15261 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false From mutation analysis, residues 109-127 were found ot be important for the intraction of Phyl with Sina. Sina was GST tagged in this experiment. sina-phyl-3 Interaction detected by cosedimentation. 15260 N/A 15262 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 15261 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Possibly the complex is made up of dimer of Phyl and dimer of Sina. ttk-phyl-3 Ttk, Phyl and Sina cosediment. 15260 N/A 15262 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 15261 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 15263 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false The three proteins are present in a common multiprotein complex.