MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint finlin-1999-1 Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Finlin BS., Andres DA. Arch. Biochem. Biophys. (0003-9861) 1999 partial coverage rapid curation finlin-1999-2 Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Finlin BS., Andres DA. Arch. Biochem. Biophys. (0003-9861) 1999 partial coverage rapid curation finlin-1999-3 Phosphorylation-dependent association of the Ras-related GTP-binding protein Rem with 14-3-3 proteins. unknown Unknown pull down pull down predetermined predetermined participant predetermined Finlin BS., Andres DA. Arch. Biochem. Biophys. (0003-9861) 1999 partial coverage rapid curation 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN rad_mouse GTP-binding protein RAD Rrad protein protein mouse Mus musculus Mouse MTLNGGSGASGSRGAGGRERDRRRGSTPWGPAPPLHRRSMPVDERDLQAALAPGSLATTAAGTRTQGQRLDWPEGSSDSLSSGGSGSEEGVYKVLLLGAPGVGKSALARIFGGIEDGPEAEAAGHTYDRSITVDGEEASLLVYDIWEEDGGCWLPGHCMAMGDAYVIVYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEDNARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL rem1_mouse GTP-binding protein REM 1 Rem1 Rem Rad and Gem-like GTP-binding protein 1 protein protein mouse Mus musculus Mouse MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSQHPRLGQSVSLNPPVRKPSPAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQDRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARRRALKARSKSCHNLAVL mint Promotes endothelial cell sprouting and actin cytoskeletal reorganization (By similarity). May be involved in angiogenesis. May function in Ca(2+) signaling rem2_mouse GTP-binding protein REM 2 Rem2 Rad and Gem-like GTP-binding protein 2 protein protein mouse Mus musculus Mouse MHTDLDTDMDMDTETVALCSSSSRQASPLGTPTPEADTTLLKQKPEKLLAELDLSGPPPAPGVPRRRGSMPVPYKHQLRRAQAVDELDWPPQASPSGSSDSLGSGEAALTQKDGVFKVMLVGESGVGKSTLAGTFGGLQGDHAHEMENSEDTYERRIMVDKEEVTLIVYDIWEQGDAGGWLQDHCLQTGDAFLIVFSVTDRRGFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRGHAGGQRPEPSSPDGPAPPTRRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL mint Binds GTP saturably and exhibits a low intrinsic rate of GTP hydrolysis ywhaz-rrad 11772 1433z_mouse 11775 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 rad_mouse 11776 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false HA-Rad and HA-Rem bind His6-1433zheta but mRem 2 does not in vitro pull down domino mint ywhaz-rem1 11772 rem1_mouse 11777 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433z_mouse 11775 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false - Pull down His6-1433 zheta, WB anti HA-rem in HEK293 lysatesrnOr HA-Rem pulled down, WB anti 1433rn- as above with deletio of Remrn- alanine scanning of single serines : all the singular mutants still interactrn- HA-Rad binds His6-1433zheta but mRem 2does notrn- Ha-Rem in complex with endogenous level 1433 35S labeledrn domino mint ywhaz-rem1-1 11773 rem1_mouse 11777 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433z_mouse 11775 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false - Pull down His6-1433 zheta, WB anti HA-rem in HEK293 lysatesrnOr HA-Rem pulled down, WB anti 1433rn- as above with deletio of Remrn- alanine scanning of single serines : all the singular mutants still interactrn- HA-Rad binds His6-1433zheta but mRem 2does notrn- Ha-Rem in complex with endogenous level 1433 35S labeledrn domino mint rem2-ywhaz 11774 rem2_mouse REM2_MOUSE 11778 unspecified role unspecified role unspecified role unspecified role 1433z_mouse 1433Z_MOUSE 11775 unspecified role unspecified role unspecified role unspecified role association association false false false domino mint