MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint poelzl-2000-1 Specific association of estrogen receptor beta with the cell cycle spindle assembly checkpoint protein, MAD2. in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Poelzl G., Kasai Y., Mochizuki N., Shaul PW., Brown M., Mendelsohn ME. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 poelzl-2000-2 Specific association of estrogen receptor beta with the cell cycle spindle assembly checkpoint protein, MAD2. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Poelzl G., Kasai Y., Mochizuki N., Shaul PW., Brown M., Mendelsohn ME. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 q9jm97_mouse ERb protein protein mouse Mus musculus Mouse MSICASSHKDFSQLRPTQDMEIKNSPSSLTSPASYNCSQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEHTLPVN fragmentation type: fragment mint md2l1_mouse Mitotic spindle assembly checkpoint protein MAD2A Mad2l1 Mad2a Mitotic arrest deficient 2-like protein 1 protein protein mouse Mus musculus Mouse MAQQLAREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLTTTDPELIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNCEEVRLRSFTTTIHKVNSMVAYKTPVND esr2-mad2l1 9745 q9jm97_mouse 9747 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 md2l1_mouse 9748 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint esr2-mad2l1-1 9746 q9jm97_mouse 9747 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 md2l1_mouse 9748 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint