MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gavin-1999-1 A MAP kinase docking site is required for phosphorylation and activation of p90(rsk)/MAPKAP kinase-1. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gavin AC., Nebreda AR. Curr. Biol. (0960-9822) 1999 gavin-1999-2 A MAP kinase docking site is required for phosphorylation and activation of p90(rsk)/MAPKAP kinase-1. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Gavin AC., Nebreda AR. Curr. Biol. (0960-9822) 1999 mk01_xenla Mitogen-activated protein kinase 1 mapk1 mpk1 Myelin xP42 protein kinase Myelin basic protein kinase M phase MAP kinase protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAAAGAASNPGGGPEMVRGQAFDVGPRYINLAYIGEGAYGMVCSAHDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPGY mint Phosphorylates microtubule-associated protein 2 (MAP2). Myelin basic protein (MBP), and Elk-1; may promote entry in the cell cycle. Activated by M phase promoting factor (MPF) ks6aa_xenla Ribosomal protein S6 kinase 2 alpha rps6ka Ribosomal protein S6 kinase II alpha MAP kinase-activated protein kinase 1 p90-RSK protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPLAQLVNLWPEVAVVHEDPENGHGSPEEGGRHTSKDEVVVKEFPITHHVKEGSEKADQSDFVLLKVLGQGSFGKVFLVRKITPPDANQLYAMKVLKKATLKVRDRVRTKMERDILADVHHPFVVRLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSNEAQSLLRALFKRNPTNRLGSAMEGAEEIKRQPFFSTIDWNKLFRREMSPPFKPAVTQADDTYYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVAPALVEEDAKKTSSPPVLSVPKTHSKNILFMDVYTVRETIGVGSYSVCKRCVHKGTNMEYAVKVIDKTKRDPSEEIEILRRYGQHPNIIALKDVYKEGNSIYVVTELMRGGELLDRILRQKFFSEREASSVLFTVCKTVENLHSQGVVHRDLKPSNILYVDESGDPESIRICDFGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGLGDTPEEILARIGSGKFTLRGGNWNTVSAAAKDLVSRMLHVDPHKRLTAKQVLQHEWITKRDALPQSQLNRQDVHLVKGAMAATYSALNSSKPTPLLQPIKSSILAQRRVKKLPSTTL Serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of transcription mint rps6ka-mapk1 2390 mk01_xenla 2392 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 ks6aa_xenla 2393 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint rps6ka-mapk1-1 2391 ks6aa_xenla 2393 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 mk01_xenla 2392 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false mint