MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint sharp-1997-1 Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins Eur. J. Biochem. (0014-2956) 1997 rapid curation rapid curation sharp-1997-2 Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins Eur. J. Biochem. (0014-2956) 1997 rapid curation rapid curation sharp-1997-3 Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). unknown Unknown protein kinase assay protein kinase assay predetermined predetermined participant predetermined Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins Eur. J. Biochem. (0014-2956) 1997 rapid curation rapid curation k3_vaccc Protein K3 K3L protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ Plays an integral role in the resistance of the virus to interferon. May bind competitively to the P1 kinase to block eIF-2-alpha phosphorylation mint e2ak2_human Interferon-induced, double-stranded RNA-activated protein kinase Interferon-inducible RNA-dependent protein kinase Eukaryotic translation initiation factor 2-alpha kinase 2 Protein kinase RNA-activated p68 kinase P1/eIF-2A protein kinase EIF2AK2 PKR PRKR Tyrosine-protein kinase EIF2AK2 protein protein human Homo sapiens Human MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC if2a_human Eukaryotic translation initiation factor 2 subunit 1 EIF2S1 EIF2A Eukaryotic translation initiation factor 2 subunit alpha protein protein human Homo sapiens Human MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED eif2ak2-k3 759832 vk03_vaccc 759835 unspecified role unspecified role prey prey e2ak2_human 759836 unspecified role unspecified role bait bait physical association physical association false false false F2 F6 homomint mint eif2ak2-eif2s1 759832 if2a_human 759837 unspecified role unspecified role prey prey e2ak2_human 759836 unspecified role unspecified role bait bait physical association physical association false false false F2 F6 homomint mint eif2ak2-k3-1 759833 vk03_vaccc 759835 unspecified role unspecified role prey prey e2ak2_human 759836 unspecified role unspecified role bait bait physical association physical association false false false F3 F4 homomint mint eif2ak2-eif2s1-1 759833 if2a_human 759837 unspecified role unspecified role prey prey e2ak2_human 759836 unspecified role unspecified role bait bait physical association physical association false false false F3 F4 homomint mint eif2ak2-eif2s1-2 759834 if2a_human 759837 unspecified role unspecified role prey prey e2ak2_human 759836 unspecified role unspecified role bait bait phosphorylation phosphorylation reaction phosphorylation false false false F5 homomint mint