HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html matsumoto-1997-1 Hepatitis C virus core protein interacts with the cytoplasmic tail of lymphotoxin-beta receptor. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Matsumoto M., Hsieh T.Y., Zhu N., VanArsdale T., Hwang S.B., Jeng K.S., Gorbalenya A.E., Lo S.Y., Ou J.H., Ware C.F., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@hsc.usc.edu Human adult liver cDNA J. Virol. (0022-538X) 1997 imex curation Only protein-protein interactions imex curation matsumoto-1997-2 Hepatitis C virus core protein interacts with the cytoplasmic tail of lymphotoxin-beta receptor. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Matsumoto M., Hsieh T.Y., Zhu N., VanArsdale T., Hwang S.B., Jeng K.S., Gorbalenya A.E., Lo S.Y., Ou J.H., Ware C.F., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@hsc.usc.edu J. Virol. (0022-538X) 1997 imex curation Only protein-protein interactions imex curation matsumoto-1997-3 Hepatitis C virus core protein interacts with the cytoplasmic tail of lymphotoxin-beta receptor. in vitro In vitro pull down pull down autoradiography autoradiography Matsumoto M., Hsieh T.Y., Zhu N., VanArsdale T., Hwang S.B., Jeng K.S., Gorbalenya A.E., Lo S.Y., Ou J.H., Ware C.F., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@hsc.usc.edu J. Virol. (0022-538X) 1997 imex curation Only protein-protein interactions imex curation matsumoto-1997-4 Hepatitis C virus core protein interacts with the cytoplasmic tail of lymphotoxin-beta receptor. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Matsumoto M., Hsieh T.Y., Zhu N., VanArsdale T., Hwang S.B., Jeng K.S., Gorbalenya A.E., Lo S.Y., Ou J.H., Ware C.F., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@hsc.usc.edu J. Virol. (0022-538X) 1997 imex curation Only protein-protein interactions imex curation matsumoto-1997-5 Hepatitis C virus core protein interacts with the cytoplasmic tail of lymphotoxin-beta receptor. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Matsumoto M., Hsieh T.Y., Zhu N., VanArsdale T., Hwang S.B., Jeng K.S., Gorbalenya A.E., Lo S.Y., Ou J.H., Ware C.F., Lai M.M. Virus - Publications including interactions involving viral proteins The E12-myogenin and ras-NF1 interactions could not be curated as the species of origin of the constructs could not be traced. Interactions involving the RH HCV isolate and the prototype HCV isolate could not be curated as the isolates ID could not be found. michlai@hsc.usc.edu Human adult liver cDNA J. Virol. (0022-538X) 1997 imex curation Only protein-protein interactions imex curation p29846-pro_0000037666 Core protein precursor protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) STNGKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTWERSQPRGRRQPIPKARQPEGRAWAQPGYPWPLYGNEGLGWAGWLVSPRGSRPNWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGVARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASA 2 191 tnr3_human Tumor necrosis factor receptor superfamily member 3 LTBR D12S370 TNFCR TNFR3 TNFRSF3 Lymphotoxin-beta receptor Tumor necrosis factor C receptor Tumor necrosis factor receptor 2-related protein Tumor necrosis factor receptor type III protein protein human Homo sapiens Human MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD core-ltbr-1 1479249 n/a 1479254 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1479255 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1479260 1479258 physical association physical association false false false Fig. 1 ltbr-p29846_pro-1 1479250 n/a 1479254 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1479255 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 2 core-ltbr-2 1479251 n/a 1479254 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1479255 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3C core-ltbr-3 1479252 n/a 1479254 unspecified role unspecified role neutral component neutral component n/a 1479255 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 4A and 4D core-ltbr-4 1479253 n/a 1479254 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1479255 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1479278 1479276 physical association physical association false false false Table1 and 2